ESTScan Details for Unigene SGN-U581375

Score 
1279
Direction 
Forward
Predicted Peptide Sequence 
MADQYEQNKASVEETVGTNVEATDRGLFDFIGKKEEEKPSHAHEEEAISSELSEKVNVSEEVEPKEEEKKLHRSNSSSSSSSDEEEEIGE
DGQKIKKKKKKGLKDKIKEKISGDHKEESKAEDTSVPVEKYEETEEKKGFLDKIKEKLPGGGHKKTEEVAAPPPPPPAAVEHEAEGKEKK
GFLDKIKEKLPGYHSKAEEEKEKEKD*
Predicted Coding Sequence 
ATGGCTGATCAATACGAACAGAACAAGGCATCCGTTGAAGAGACTGTTGGTACCAACGTGGAAGCTACTGATCGTGGTTTGTTTGATTTC
ATTGGAAAAAAAGAAGAGGAAAAACCAAGTCATGCTCATGAAGAAGAGGCAATTTCATCTGAGTTGTCTGAAAAAGTTAACGTAAGTGAA
GAAGTGGAACCCAAGGAGGAGGAAAAGAAACTTCATCGATCAAATAGCAGCTCTAGTAGCTCCAGTGATGAGGAGGAAGAAATTGGAGAG
GATGGACAGAAGATCAAGAAGAAGAAAAAGAAGGGATTGAAGGATAAGATTAAGGAAAAAATATCTGGTGATCACAAGGAAGAATCGAAA
GCAGAGGATACCTCAGTTCCAGTTGAGAAATACGAGGAAACAGAGGAGAAAAAAGGATTTCTAGACAAAATTAAGGAGAAATTGCCAGGT
GGCGGGCATAAGAAGACGGAGGAAGTGGCGGCGCCACCACCACCACCACCGGCTGCGGTGGAGCATGAGGCGGAGGGGAAGGAGAAGAAG
GGATTTTTGGACAAAATTAAGGAGAAATTACCAGGATACCACTCAAAGGCTGAAGAGGAAAAGGAGAAGGAAAAAGACTAA
Edits in Original Sequence 
GCTTTTTTTTTATTACTATATCGAAAATAAAAAAATCTTAATCAGCGTAACGTCCGTGTTTGTAATTGCTATAAAAGGCGATTGGCGGCC
AATCGGCCGAATTGACATCCAATTCAATATTCAAACTTTCACTTGTTGATAATATCTTTTTGATTGAAAAAAAGAAGAAGAAGT
(5')AT
GGCTGATCAATACGAACAGAACAAGGCATCCGTTGAAGAGACTGTTGGTACCAACGTGGAAGCTACTGATCGTGGTTTGTTTGATTTCAT
TGGAAAAAAAGAAGAGGAAAAACCAAGTCATGCTCATGAAGAAGAGGCAATTTCATCTGAGTTGTCTGAAAAAGTTAACGTAAGTGAAGA
AGTGGAACCCAAGGAGGAGGAAAAGAAACTTCATCGATCAAATAGCAGCTCTAGTAGCTCCAGTGATGAGGAGGAAGAAATTGGAGAGGA
TGGACAGAAGATCAAGAAGAAGAAAAAGAAGGGATTGAAGGATAAGATTAAGGAAAAAATATCTGGTGATCACAAGGAAGAATCGAAAGC
AGAGGATACCTCAGTTCCAGTTGAGAAATACGAGGAAACAGAGGAGAAAAAAGGATTTCTAGACAAAATTAAGGAGAAATTGCCAGGTGG
CGGGCATAAGAAGACGGAGGAAGTGGCGGCGCCACCACCACCACCACCGGCTGCGGTGGAGCATGAGGCGGAGGGGAAGGAGAAGAAGGG
ATTTTTGGACAAAATTAAGGAGAAATTACCAGGATACCACTCAAAGGCTGAAGAGGAAAAGGAGAAGGAAAAAGACTAA(3')ATGAAAT
GAAATGTTTTTTTAATTTTACTTTTGGGATGTTATGATTGTGTTTCTGTGTTGTTTTGGTTTTTAAGTGTTTTTCATTTCCTTCACTTTT
GTTTTTTTTGGATTCTGAAGGATAATTGTTAGTACTGTATTTGATATTTCTGTATGTAAGTGCATATGTATGTGCCTTATGTGTATGAAG
TTTGATAATATGGATTTGTAAAATGCAGTTGATTTTATCCTTATTGACTTCTTTGTTTTATGGTTAAGTTGTTTCATTTCCAACTCTGTT
ATATGAAAACGTATTGTTCAAAACATATCGAGTTATTATATATAAATGCAAATCTTAGAGATATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan