Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U581493

Score 
609
Direction 
Forward
Predicted Peptide Sequence 
MAQYGNQDQMRKTDEYGNHVQETGVYQGTGTGGMMGGTGTGGMMGGTGGEYGTQGMGTGTHHHEGQQQLRRSDSSSSSEDDGEGGRRKKG
LKEKIMEKMPGQHEGEYGQTTGEEKKGMMDKIKDKIPGMH*
Predicted Coding Sequence 
ATGGCACAATACGGCAATCAAGACCAAATGCGCAAGACTGATGAATATGGAAACCATGTCCAAGAAACAGGAGTCTATCAAGGTACCGGT
ACTGGCGGTATGATGGGGGGCACGGGTACTGGCGGTATGATGGGGGGCACTGGTGGAGAATATGGAACTCAAGGCATGGGTACTGGTACT
CATCACCATGAGGGGCAACAGCAGCTTCGTCGATCCGACAGCTCTAGCTCGTCGGAGGATGATGGAGAAGGTGGGAGGAGAAAGAAGGGT
TTGAAGGAGAAGATAATGGAGAAGATGCCTGGACAACATGAAGGTGAGTATGGACAAACAACAGGTGAAGAGAAGAAAGGAATGATGGAC
AAAATCAAGGACAAGATCCCTGGGATGCATTGA
Edits in Original Sequence 
CGGCCGATTCCCATGGGGATCCGATGACTTGAATGTTATCTGCAGTAGCCAAAAACAAAGTAAAAAATTAAACAGTGTTTTTTAAAAAAA
AAGAATTTTTGATCAAAG
(5')ATGGCACAATACGGCAATCAAGACCAAATGCGCAAGACTGATGAATATGGAAACCATGTCCAAGAAAC
AGGAGTCTATCAAGGTACCGGTACTGGCGGTATGATGGGGGGCACGGGTACTGGCGGTATGATGGGGGGCACTGGTGGAGAATATGGAAC
TCAAGGCATGGGTACTGGTACTCATCACCATGAGGGGCAACAGCAGCTTCGTCGATCCGACAGCTCTAGCTCGTCGGAGGATGATGGAGA
AGGTGGGAGGAGAAAGAAGGGTTTGAAGGAGAAGATAATGGAGAAGATGCCTGGACAACATGAAGGTGAGTATGGACAAACAACAGGTGA
AGAGAAGAAAGGAATGATGGACAAAATCAAGGACAAGATCCCTGGGATGCATTGA(3')ACACCTTTGTTTTCATCTCCATCTTATCTTA
TGAATAAATAAGGTAGTGCTTGATTCTATTTCATGCACTAATTAGTAGTAATCGTTATGCCAGTAATTATCTAATTACGTACACTCTTGT
GTTTAAAGTCGTGTAAAGTGTGCTGACGCTATATACATGTGTGTGTATATTGGCGGCCATGCCCTGCCCCTTCTGTATTTTTAAAACAAG
AATATTGCTTCCATGCTTGGAAAGCAATGATCATGTTGATGTGTGTTATGGTGTCCCGTGTTTAATGATGTTTTGGAAATAATATAACTT
GTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan