ESTScan Details for Unigene SGN-U581613

Score 
988
Direction 
Forward
Predicted Peptide Sequence 
MALSSSTFAGKAXKSSSEITGNGRFTMRKTAAAKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGDYGWDTAGLSADPETFAKNRELEV
IHCRWAMLGACSWLCISRAISLKFGEAVWFSNFQWGGLDYLGSMHKVSWPFGLDGAVEGHRIAGGPLGEVVDPLYPGGSFDPLGLAELKV
EEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPENEVDSSSPIVNYW
Predicted Coding Sequence 
ATGGCTCTTTCTTCATCTACATTTGCTGGAAAGGCAGXTAAATCTTCTTCTGAAATCACCGGAAATGGAAGATTCACCATGAGGAAGACT
GCCGCTGCCAAGGCCAAGCCTGTCTCTTCTGGTAGTCCATGGTATGGGCCTGACCGTGTGAAGTATTTGGGCCCATTCTCTGGTGAATCC
CCAAGCTACTTGACTGGTGACTACGGATGGGACACTGCTGGACTTTCAGCTGATCCAGAAACTTTTGCTAAGAACCGTGAGTTGGAGGTT
ATCCATTGTAGATGGGCCATGCTTGGAGCATGCTCTTGGTTGTGTATTTCCCGAGCTATTAGCCTAAAGTTTGGGGAGGCTGTTTGGTTC
TCAAATTTTCAGTGGGGTGGACTTGATTACTTGGGGTCCATGCACAAAGTATCTTGGCCATTTGGGCTTGATGGGGCCGTTGAGGGTCAC
CGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGATCCACTTTACCCTGGTGGTAGCTTCGACCCATTGGGCCTTGCTGAACTCAAAGTA
GAGGAGATCAAGAATGGGAGACTTGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTCACAGGAAAAGGCCCATTGGAAAAT
CTTGCAGACCACATCGCTGATCCAGTTAACAACAATGCATGGGCTTTTGCCACAAACTTTGTTCCAGAAAATGAAGTAGACTCATCTAGC
CCTATTGTAAATTACTGG
Edits in Original Sequence 
TCAACTCCTCTTGTTCATTTTTTCTTTTATAAAAGTGTGTGCACAAAGTGCATTCTCATTCTACTTTTACA(5')ATGGCTCTTTCTTCA
TCTACATTTGCTGGAAAGGCAGXTAAATCTTCTTCTGAAATCACCGGAAATGGAAGATTCACCATGAGGAAGACTGCCGCTGCCAAGGCC
AAGCCTGTCTCTTCTGGTAGTCCATGGTATGGGCCTGACCGTGTGAAGTATTTGGGCCCATTCTCTGGTGAATCCCCAAGCTACTTGACT
GGTGACTACGGATGGGACACTGCTGGACTTTCAGCTGATCCAGAAACTTTTGCTAAGAACCGTGAGTTGGAGGTTATCCATTGTAGATGG
GCCATGCTTGGAGCATGCTCTTGGTTGTGTATTTCCCGAGCTATTAGCCTAAAGTTTGGGGAGGCTGTTTGGTTCTCAAATTTTCAGTGa
GGGTGGACTTGATTACTTGGGGTCCATGCACAAAGTATCTTGGCCATTTGGGCTTGATGGGaGCCGTTGAGGGTCACCGTATTGCTGGTG
GGCCTCTTGGTGAGGTTGTTGATCCACTTTACCCTGGTGGTAGCTTCGACCCATTGGGCCTTGCTGAACTCAAAGTAGAGGAGATCAAGA
ATGGGAGACTTGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTCACAGGAAAAGGCCCATTGGAAAATCTTGCAGACCACA
TCGCTGATCCAGTTAACAACAATGCATGGGCTTTTGCCACAAACTTTGTTCCAgGAAAATGAAGTAGACTCATCTAGCCCTATTGTAAAT
TACTGG(3')AGATTATATATGAACTTTTTTATTTGGTCTTCAAACATTGTCTAGTTCCATAATATTATTTTATGTTTACATTTTGCAAT
AGTAGTATGAGCTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan