Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U581714

Score 
507
Direction 
Forward
Predicted Peptide Sequence 
MAPKGKVISCRAAVAYGPGQPLVVEQVQVDPPQKMEVRIKILFTSICHTDLSAWKGESEAQRAYPRILGHEASGVVESVGEGVIDMKEGD
QVVAIFNGECGECIYCKSSKKTNLCGKFRVNPFKSVMESDGKCRFRNKDGIPIYHFLSTSTFTEYTVVDSACLVKIDPHASLDKMTLLSC
GVSTGLGAAWNTADVQTGETVAVFGLGAVGLAVVEGARTRGASKIIGVDINPEKRIKGEAIGITDFINPKEIDVPVHEKIREMSEGGVDY
SFECAGNMQVLXRGIFIHT*
Predicted Coding Sequence 
ATGGCTCCAAAGGGCAAGGTCATCAGTTGCAGAGCTGCTGTAGCGTATGGTCCAGGGCAGCCGTTGGTGGTAGAACAAGTGCAGGTAGAT
CCACCTCAGAAAATGGAGGTCCGAATTAAGATTCTCTTTACTTCCATCTGTCACACGGATCTCAGTGCTTGGAAAGGCGAGAGCGAAGCT
CAACGAGCTTATCCTCGAATTCTGGGACATGAAGCATCGGGAGTGGTGGAGAGCGTGGGAGAAGGTGTAATTGACATGAAAGAGGGAGAT
CAAGTCGTAGCGATTTTCAATGGTGAATGCGGAGAGTGCATATATTGCAAATCATCAAAGAAAACCAACTTGTGTGGCAAGTTCCGCGTC
AATCCATTCAAAAGTGTGATGGAAAGTGACGGAAAATGCAGGTTCAGGAACAAGGATGGCATACCCATTTATCATTTTCTTAGTACTTCA
ACATTCACCGAATACACTGTTGTTGATTCTGCTTGCTTAGTCAAAATTGACCCTCATGCCTCACTTGACAAGATGACCTTGCTTAGCTGC
GGCGTATCCACTGGTCTAGGGGCTGCGTGGAACACGGCTGACGTTCAAACAGGGGAAACGGTGGCAGTCTTTGGATTAGGAGCTGTTGGT
TTGGCCGTTGTTGAAGGGGCACGGACCAGAGGCGCCTCAAAGATCATAGGGGTGGATATTAACCCTGAAAAACGTATTAAAGGTGAAGCA
ATTGGAATTACTGACTTCATCAATCCCAAAGAAATCGATGTGCCCGTCCATGAGAAAATAAGGGAAATGAGCGAGGGGGGCGTGGACTAT
AGCTTTGAGTGTGCTGGAAATATGCAAGTTCTTCXGAGAGGCATTTTTATCCACACATGA
Edits in Original Sequence 
CCCTGCAGTTTGCATAAATTGACTAGGAAAGAAAGCCCCCAAAATTGAAAC(5')ATGGCTCCAAAGGGCAAGGTCATCAGTTGCAGAGC
TGCTGTAGCGTATGGTCCAGGGCAGCCGTTGGTGGTAGAACAAGTGCAGGTAGATCCACCTCAGAAAATGGAGGTCCGAATTAAGATTCT
CTTTACTTCCATCTGTCACACGGATCTCAGTGCTTGGAAAGGCGAGAGCGAAGCTCAACGAGCTTATCCTCGAATTCTGGGACATGAAGC
ATCGGGAGTGGTGGAGAGCGTGGGAGAAGGTGTAATTGACATGAAAGAGGGAGATCAAGTCGTAGCGATTTTCAATGGTGAATGCGGAGA
GTGCATATATTGCAAATCATCAAAGAAAACCAACTTGTGTGGCAAGTTCCGCGTCAATCCATTCAAAAGTGTGATGGAAAGTGACGGAAA
ATGCAGGTTCAGGAACAAGGATGGCATACCCATTTATCATTTTCTTAGTACTTCAACATTCACCGAATACACTGTTGTTGATTCTGCTTG
CTTAGTCAAAATTGACCCTCATGCCTCACTTGACAAGATGACCTTGCTTAGCTGCGGCGTATCCACTGGTCTAGGGGCTGCGTGGAACAC
GGCTGACGTTCAAACAGGGGAAACGGTGGCAGTCTTTGGATTAGGAGCTGTTGGTTTGGCCGTTGTTGAAGGGGCACGGACCAGAGGCGC
CTCAAAGATCATAGGGGTGGATATTAACCCTGAAAAACGTATTAAAGGTGAAGCAATTGGAATTACTGACTTCATCAATCCCAAAGAAAT
CGATGTGCCCGTCCATGAGAAAATAAGGGAAATGAGCGAGGGGGGCGTGGACTATAGCTTTGAGTGTGCTGGAAATATGCAAGTTCTTCX
GAGAGGCATTTTTATCCACACATGA(3')TGCAAGTTTTTTTTTTTCTTTTTTTTTTTGTACTATTTATTTATCTACAGAATTATAGAAG
ATTTAAAAAGAAACCCCTCTTTCTACTTATTATAGGGATGGGGCATGGCAATCGTTTTAGGAATTCATCCGACACCAAAATTGCTATCAC
TCCATCCAATGGAACTGTTCGATGGCAGAAGGATTGTGGCTTCTGTCTTTGGTGACTTCAAAGGAAAATCCCAACTCCCTTTTTTAGCTG
AACAATGCATGGCTGGGGTGGTCAAATTAGACGAGTTTATTACTCACAGACTACCATTTGAGAAGATCAATGAAGCTTTTCAACTGCTTC
TCGATGGCAAATCCTTGAGATGCCTTCTTCATCTTTCCTAATAGTAACAAATTTATTAAAGCAATTCCTCCTATCCTGTATTCTATTATT
CTGCACTTTCAAAATATATTGTATTTACTTTCTACATGTTTTATCAATGGAGTAAATTTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan