ESTScan Details for Unigene SGN-U581990

Score 
1459
Direction 
Forward
Predicted Peptide Sequence 
MVEHDFHQQTQSLVKLVVLVCLLFLSASISVEARIRHYQWEVKYEYKSPDCFKKLSISINGKTPGPTIVAQQGDTVVVEVKNSLLTENLA
IHWHGIRQIGTPWADGTEGVTQCPIVPGDTFIYKFVVDRAGTYLYHAHYGMQRQAGLQGMMRVSLPDGVLEPFSYDHDRSILLTDWYHKS
TYEQATGLAXIAFFLGWRTSVNLDSWKRKIQLFYSAIDPTLCNATNPQCTPYSMTVVPGKTYRLRIGSLTALSALSFEIEGHNMTVVEAD
GHYVEPFVVKNLFIYSGETYSVLIKADQDPTRNYWASTKVVSRNNTTPNGLGIFNYYPNHPRRYPPTVPPSGPRWDDVAPRMAQSVAIKS
HRDFIHAPPLTSDRVIVMLNTQNRVNGYVRWSVNNVSFNMPHTPYLIALKHNLLHAFEQTPPPDNYDQKNYDIFNIAPNVNATTSNSIYR
LKFNTTVDIILQNANTMNLNNSETHPWHLHGHDFWVMGYGNGKFNQSIDPKNYNFVNPIMKNTIPVHPYGWTALRFRADNPGVWAFHCHI
ESHFFMGMGVVFEEGIEKVGKLPTSIMGCGESKRFHRP*
Predicted Coding Sequence 
ATGGTTGAGCATGATTTTCATCAACAAACTCAAAGTTTAGTTAAGTTGGTGGTACTTGTATGTTTGTTATTTCTATCTGCTAGTATTTCA
GTTGAAGCGCGAATTCGTCATTATCAATGGGAAGTTAAATATGAATATAAATCCCCAGATTGTTTCAAAAAACTCTCTATTAGCATCAAT
GGTAAAACTCCAGGACCTACTATTGTTGCTCAACAAGGTGACACTGTTGTTGTTGAAGTTAAAAATAGCTTGTTAACTGAAAATCTTGCT
ATTCATTGGCATGGAATTAGACAGATTGGAACACCATGGGCTGATGGAACAGAAGGAGTGACACAATGTCCTATTGTGCCAGGGGATACT
TTTATATACAAATTTGTTGTTGATAGGGCTGGAACATATTTGTACCATGCTCATTATGGTATGCAAAGACAAGCAGGACTACAAGGAATG
ATGAGAGTATCATTACCTGATGGAGTTTTAGAGCCATTTTCATATGATCATGATAGGAGTATTCTTCTCACTGATTGGTACCACAAGAGC
ACTTATGAACAAGCAACTGGTCTTGCTXTCATTGCCTTTTTCTTGGGTTGGAGAACCTCAGTCAATCTTGATTCATGGAAGAGGAAGATT
CAATTGTTCTATTCCGCCATAGATCCTACTCTTTGTAATGCTACAAATCCTCAATGTACACCTTATTCAATGACTGTGGTTCCTGGCAAG
ACTTATAGGCTTAGAATTGGCAGCTTGACTGCTCTTTCAGCTCTAAGTTTTGAAATTGAGGGGCATAACATGACAGTTGTTGAGGCAGAC
GGTCACTATGTGGAGCCATTTGTGGTAAAAAATCTGTTCATTTATTCTGGAGAAACATACTCAGTCCTAATTAAAGCTGATCAAGACCCT
ACAAGAAATTATTGGGCAAGTACAAAAGTTGTCAGCAGGAATAATACTACTCCAAATGGTTTGGGTATTTTCAATTATTACCCAAACCAT
CCTAGGAGATATCCTCCTACTGTACCACCCTCGGGGCCACGTTGGGATGACGTTGCCCCCAGGATGGCTCAGAGTGTTGCTATCAAGTCC
CACAGAGATTTCATCCATGCCCCTCCTCTGACATCGGACAGGGTCATAGTCATGCTCAACACACAAAATAGGGTGAACGGGTATGTACGT
TGGTCAGTCAACAACGTCTCATTCAACATGCCCCATACGCCTTACCTGATCGCCCTTAAACACAACTTGTTACATGCTTTCGAGCAAACC
CCTCCTCCGGACAACTATGACCAAAAGAATTACGACATCTTCAATATCGCGCCAAATGTGAATGCTACAACTAGCAACTCGATTTATCGA
TTGAAGTTCAACACAACAGTGGACATCATATTGCAAAATGCCAACACAATGAACCTAAACAACAGTGAGACACATCCTTGGCATTTACAT
GGACATGACTTTTGGGTCATGGGCTATGGTAATGGCAAGTTTAACCAATCTATTGATCCAAAGAATTACAACTTTGTGAACCCAATAATG
AAAAACACAATCCCAGTCCATCCTTATGGATGGACCGCATTGCGATTTCGGGCCGATAATCCAGGAGTTTGGGCCTTCCATTGCCATATT
GAGTCACATTTCTTCATGGGAATGGGAGTTGTATTTGAAGAAGGAATTGAGAAAGTTGGCAAATTGCCTACTTCTATTATGGGCTGTGGA
GAAAGTAAAAGGTTCCACAGGCCTTAA
Edits in Original Sequence 
CTTAGTCAAAATAACCTGCCATATTTGATTGACCAAGCCATTAAGAAACTACTATATATATATATAAATTAGATCCACAAACAAATCTTC
TTAGACCAAAAAAAAGATCAAAGCAAAATAACGAAGTCATAATTTTGTTATTCAAGTTCAATCCAAC
(5')ATGGTTGAGCATGATTTTC
ATCAACAAACTCAAAGTTTAGTTAAGTTGGTGGTACTTGTATGTTTGTTATTTCTATCTGCTAGTATTTCAGTTGAAGCGCGAATTCGTC
ATTATCAATGGGAAGTTAAATATGAATATAAATCCCCAGATTGTTTCAAAAAACTCTCTATTAGCATCAATGGTAAAACTCCAGGACCTA
CTATTGTTGCTCAACAAGGTGACACTGTTGTTGTTGAAGTTAAAAATAGCTTGTTAACTGAAAATCTTGCTATTCATTGGCATGGAATTA
GACAGATTGGAACACCATGGGCTGATGGAACAGAAGGAGTGACACAATGTCCTATTGTGCCAGGGGATACTTTTATATACAAATTTGTTG
TTGATAGGGCTGGAACATATTTGTACCATGCTCATTATGGTATGCAAAGACAAGCAGGACTACAAGGAATGATGAGAGTATCATTACCTG
ATGGAGTTTTAGAGCCATTTTCATATGATCATGATAGGAGTATTCTTCTCACTGATTGGTACCACAAGAGCACTTATGAACAAGCAACTG
GTCTTGCTXTCATTGCCTTTTTCTTGGGTTGGAGAACCTCAGTCAATCTTGATTCATGGAAGAGGAAGATTCAATTGTTCTATTCCGaCC
ATAGATCCTACTCTTTGTAATGCTACAAATCCTCAATGTACACCTTATTCAATGACTGTGGTTCCTGGCAAGACTTATAGGCTTAGAATT
GGCAGCTTGACTGCTCTTTCAGCTCTAAGTTTTGAAATTGAGGGGCATAACATGACAGTTGTTGAGGCAGACGGTCACTATGTGGAGCCA
TTTGTGGTAAAAAATCTGTTCATTTATTCTGGAGAAACATACTCAGTCCTAATTAAAGCTGATCAAGACCCTACAAGAAATTATTGGGCA
AGTACAAAAGTTGTCAGCAGGAATAATACTACTCCAAATGGTTTGGGTATTTTCAATTATTACCCAAACCATCCTAGGAGATATCCTCCT
ACTGTACCACCCTCGGGGCCACGTTGGGATGACGTTGCCCCCAGGATGGCTCAGAGTGTTGCTATCAAGTCCCACAGAGATTTCATCCAT
GCCCCTCCTCTGACATCGGACAGGGTCATAGTCATGCTCAACACACAAAATAGGGTGAACGGGTATGTACGTTGGTCAGTCAACAACGTC
TCATTCAACATGCCCCATACGCCTTACCTGATCGCCCTTAAACACAACTTGTTACATGCTTTCGAGCAAACCCCTCCTCCGGACAACTAT
GACCAAAAGAATTACGACATCTTCAATATCGCGCCAAATGTGAATGCTACAACTAGCAACTCGATTTATCGATTGAAGTTCAACACAACA
GTGGACATCATATTGCAAAATGCCAACACAATGAACCTAAACAACAGTGAGACACATCCTTGGCATTTACATGGACATGACTTTTGGGTC
ATGGGCTATGGTAATGGCAAGTTTAACCAATCTATTGATCCAAAGAATTACAACTTTGTGAACCCAATAATGAAAAACACAATCCCAGTC
CATCCTTATGGATGGACCGCATTGCGATTTCGGGCCGATAATCCAGGAGTTTGGGCCTTCCATTGCCATATTGAGTCACATTTCTTCATG
GGAATGGGAGTTGTATTTGAAGAAGGAATTGAGAAAGTTGGCAAATTGCCTACTTCTATTATGGGCTGTGGAGAAAGTAAAAGGTTCCAC
AGGCCTTAA(3')ATTCTATAACATTATTGTCCAAAACAGATTACTTTGGTTTAATATTATTTTGATTCTTTTGATAGTTGCCAAAAATC
AAAGGCCAGTAAAAAATGTGTTCCTTTTTGTTGTAAAACCTCTACCCTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan