ESTScan Details for Unigene SGN-U582042

Score 
85
Direction 
Forward
Predicted Peptide Sequence 
XGQKQLLCLARALLKSCKVLCLDECTANVDTETTSKLQKTLATECHGTTVITIAHRISTXYEYGQYPDFGSRVPGKRTFLTSFPSFKLSR
HKXLNHKNITKVAGCFDIXLSLFGLIIYYYTYLESRGQTLFLKTKIVVLMFGTWFKALTDMNNQTSLGTQSSDHPTGEHSTIFFDY*
Predicted Coding Sequence 
XTTGGTCAAAAGCAGCTACTCTGCCTAGCACGTGCTCTCCTCAAGTCCTGCAAGGTGCTTTGCTTGGATGAATGCACGGCAAATGTGGAC
ACTGAAACAACTTCAAAACTACAGAAAACTCTAGCCACCGAATGCCATGGAACAACGGTTATCACAATTGCCCATCGCATTTCAACAGXT
TATGAGTATGGACAATATCCTGATTTTGGATCGAGGGTTCCTGGTAAACGTACTTTCTTGACAAGCTTCCCTTCGTTTAAACTGTCTAGA
CATAAGAAXTTGAATCATAAGAATATAACAAAAGTAGCTGGTTGCTTTGACATTXTTTTAAGTCTCTTCGGGCTAATTATTTACTATTAT
ACTTATCTGGAAAGTAGGGGTCAAACATTATTCCTTAAAACAAAGATTGTTGTTTTAATGTTCGGAACTTGGTTTAAGGCCCTXACTGAT
ATGAACAACCAAACAAGTCTTGGCACTCAATCTAGTGATCATCCTACTGGTGAACATTCTACAATATTCTTCGATTATTAG
Edits in Original Sequence 
(5')XTTGGTCAAAAGCAGCTACTCTGCCTAGCACGTGCTCTCCTCAAGTCCTGCAAGGTGCTTTGCTTGGATGAATGCACGGCAAATGT
GGACACTGAAACAACTTCAAAACTACAGAAAACTCTAGCCACCGAATGCCATGGAACAACGGTTATCACAATTGCCCATCGCATTTCAAC
AGXTTATGAGTATGGACAATATCCTGATTTTGGATCGAGGGTTCCTGGTAAACGTACTTTCTTGACAAGCTTCCCTTCGTTTAAACTGTC
TAGACATAAGAAXTTGAATCATAAGAATATAACAAAAGTAGCTGGTTGCTTTGACATTXTTTTAAGTCTCTTCGGGCTAATTATTTACTA
TTATACTTATCTGGAAAGTAGGGGTCAAACATTATTCCTTAAAACAAAGATTGTTGTTTTAATGTTCGGAACTTGGTTTAAGGCCCTXAC
TGATATGAACAACCAAACAAGTCTTGGCACTCAATCTAGTGATCATCCTACTGGTGAACATTCTACAATATTCTTCGATTATTAG(3')A
TTGATGCATGTTATATAAGAGGAACGAAGCAGAAAAAGAAAGATCATCCCAATTGTGATTGTTCTAGTTCCTCATTTTACTTTTTTTTTT
TTTTTTTTTTGCTTTACAGGTTGAACAGGGTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan