ESTScan Details for Unigene SGN-U582064

Score 
140
Direction 
Reverse
Predicted Peptide Sequence 
MTNTQQKFQFQITQKKIPSASSSIFSHQCLLRPSEYCESGTTSDNGVDIGVGNGEFRQTGHEAFNFSHHLRTSHENNAYTQVTSVTSPLP
CNRTNKSHTRRRFCFRFRFPNFRFCLSKLIWVRVDYCLIEARESVRDETSSFSSSSATKITLGXVNSGVRVSRLGLGLTAAIGSGAAAXG
XDERMRVDRRKRKARAIAIAVAEAYFVEALDELLVVVRGGGGTAVAAEGMVDIGRILREAPLD*
Predicted Coding Sequence 
ATGACTAATACTCAACAGAAATTCCAATTTCAAATTACACAAAAGAAAATTCCAAGCGCTTCCTCATCTATTTTCAGTCATCAATGTCTT
CTCCGACCATCGGAATATTGTGAAAGTGGGACCACCTCCGACAACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGA
CATGAAGCATTCAATTTCAGCCACCATCTACGCACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCT
TGTAATCGCACAAACAAATCGCACACACGACGTCGTTTCTGCTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATT
TGGGTAAGAGTTGATTACTGCTTGATTGAGGCCCGCGAAAGTGTTCGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATT
ACACTCGGAXATGTAAATTCCGGTGTTCGGGTTTCGAGACTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGT
AAXGATGAAAGGATGAGAGTTGATAGGAGGAAGAGGAAGGCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTC
GATGAGCTATTGGTGGTGGTTAGAGGTGGTGGTGGXACCGCCGTGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCT
CCATTAGATTAA
Edits in Original Sequence 
TAGATCTAGAAATATATTCTTTCTTTGAAATCTAAAATCAGAGA(5')ATGACTAATACTCAACAGAAATTCCAATTTCAAATTACACAA
AAGAAAATTCCAAGCGCTTCCTCATCTATTTTCAGTCATCAATGTCTTCTCCGACCATCGGAATATTGTGAAAGTGGGACCACCTCCGAC
AACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGACATGAAGCATTCAATTTCAGCCACgCATCTACGCACATCACA
TGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCTTGTAATCGCACAAACAAATCGCACACACGACGTCGTTTCTG
CTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATTTaGGGTAAGAGTTGATTACTGCTTGATTGAGGCCCGCGAAA
GTGTTCtGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATTACACTCGGAXATGTAAATTCCGGTGTTCGGGTTTCGAGA
CTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGTAAXGATGAAAGGATGAGAGTTGATAGGAGGAAGAGGAAG
GCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTCGATGAGCgTATTGGTGGTGGTTAGAGGTGGTGGTGGXAC
CGCCGTaGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCTCCATTAGATTAA(3')AGGGAAAAAATATGGTTTAGA
TAGGTGGGTGGGTGCATGGGTGGGTGGTATAGCTGGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan