ESTScan Details for Unigene SGN-U582141

Score 
895
Direction 
Forward
Predicted Peptide Sequence 
GDFTAFIGPIXEFDRGSCSDLQSNAFPLQEEGTSEEESKRFEMLYYRQQIKCLHDIYFDLLEKLELCLKKMEESLALKEKGEGEPLVSGW
SQYFAILKEINAISKLYKGSEDEFWNRMRHRKVSLCFLIMRFAKRSEDHRWILEHKEVTNFEVRRYLAMMMLPEVKDEYEELHEMLIDRA
QLLSESFEYIAHADPESLRGGLFMEFKSEEATGPGRLEGVVFLGMSSNLQPSEALFVACPNDRRRFFPNPASKVDPLHLEYFSFSGRVIA
LALMHKIQVGIVFDRVFFLQLSGKSISLDDIRDADPFLYSSCRQILEMDPEMVDQDTLGLTFVREVEELGSRKVVELCPNGKSTMVNSKN
RKQYVELLIQHRFVTSIAEQVAHFAQGFADIXNLRKAPEILFPELKLEDLDWMLHGSETAVSVEDWKAHTDYNGYKESDPQISWFWKIVG
CMTAEQRKVLLFFWTSIKYLPVEGFGGLASRLYIYKTRESNDRLPSSHTCFFRLCFPPYPSMDAMQDRLHIITQEHVGCSFGTGNIIDLF
GPESDCT*
Predicted Coding Sequence 
GGTGATTTTACTGCATTTATAGGTCCTATTXATGAATTTGATCGGGGATCATGTAGCGATTTGCAGTCCAATGCTTTCCCGTTGCAGGAG
GAAGGCACCAGTGAGGAGGAAAGCAAAAGATTTGAGATGTTGTATTACAGACAGCAGATTAAATGTTTGCATGATATTTACTTTGATTTG
CTTGAGAAATTAGAGCTATGTCTAAAGAAAATGGAAGAATCTTTAGCATTGAAAGAGAAAGGAGAAGGTGAGCCTCTTGTATCCGGGTGG
TCCCAGTATTTTGCAATTCTGAAGGAGATAAATGCTATATCAAAACTTTATAAGGGCTCGGAGGATGAATTTTGGAATAGAATGAGGCAT
AGAAAAGTTTCATTGTGTTTTCTGATTATGAGATTTGCAAAACGATCTGAAGATCATCGGTGGATTTTGGAGCACAAGGAGGTGACTAAT
TTTGAGGTGAGGAGGTATCTAGCCATGATGATGCTTCCAGAAGTGAAGGACGAGTACGAGGAGCTACACGAGATGCTCATTGACCGCGCT
CAGTTGCTCTCAGAATCTTTTGAGTACATTGCACATGCAGATCCTGAGTCATTACGTGGTGGTTTGTTTATGGAGTTCAAGAGTGAAGAA
GCTACGGGGCCTGGXCGTCTTGAGGGAGTGGTTTTTCTTGGTATGTCGAGCAATCTTCAACCCTCAGAAGCACTGTTTGTTGCTTGTCCA
AATGACCGCAGAAGGTTCTTTCCAAATCCAGCGTCGAAGGTGGACCCGTTGCACCTTGAGTATTTTAGCTTCTCTGGCAGGGTAATTGCT
TTGGCCTTAATGCATAAAATACAAGTCGGCATTGTCTTTGACCGCGTGTTCTTCTTACAATTGTCGGGCAAGAGTATTTCCTTGGATGAC
ATAAGGGATGCAGATCCATTCTTGTACAGCAGCTGCAGGCAGATATTGGAGATGGATCCGGAGATGGTAGATCAAGATACTCTTGGTTTG
ACATTTGTTCGTGAAGTAGAAGAGTTAGGATCCAGGAAGGTTGTCGAGCTGTGCCCTAATGGGAAAAGTACCATGGTGAATAGTAAAAAT
AGGAAGCAGTATGTTGAGCTTCTTATTCAGCACCGCTTTGTCACATCCATTGCTGAGCAGGTAGCTCATTTTGCTCAAGGTTTTGCTGAC
ATTXATAACCTCCGTAAGGCTCCAGAAATCCTTTTTCCAGAGCTTAAACTTGAAGATCTTGATTGGATGCTCCACGGGAGTGAAACTGCT
GTTTCTGTGGAAGACTGGAAAGCACATACTGATTATAATGGCTATAAAGAAAGTGATCCTCAAATATCTTGGTTTTGGAAGATTGTTGGG
TGCATGACAGCTGAGCAGAGAAAGGTTCTCCTCTTCTTTTGGACTTCAATAAAGTATCTTCCCGTCGAGGGTTTTGGAGGTTTGGCCTCT
AGGCTTTACATCTACAAAACCAGAGAGTCAAATGATCGTTTGCCTTCTTCACACACGTGCTTCTTCCGCCTATGCTTTCCTCCTTATCCA
TCCATGGATGCCATGCAAGATCGACTTCACATTATCACCCAAGAGCATGTAGGTTGCAGCTTTGGTACTGGTAACATCATCGATCTTTTT
GGACCTGAATCAGACTGCACATAA
Edits in Original Sequence 
(5')GGTGATTTTACTGCATTTATAGGTCCTATTXATGAATTTGATCGGGGATCATGTAGCGATTTGCAGTCCAATcGCTTTCCCGTTGC
AGGAGGAAGGCACCAGTGAGGAGGAAAGCAAAAGATTTGAGATGTTGTATTACAGACAGCAGATTAAATGTTTGCATGATATTTACTTTG
ATTTGCTTGAGAAATTAGAGCTATGTCTAAAGAAAATGGAAGAATCTTTAGCATTGAAAGAGAAAGGAGAAGGTGAGCCTCTTGTATCCG
GGTGGTCCCAGTATTTTGCAATTCTGAAGGAGATAAATGCTATATCAAAACTTTATAAGGGCTCGGAGGATGAATTTTGGAATAGAATGA
GGCATAGAAAAGTTTCATTGTGTTTTCTGATTATGAGATTTGCAAAACGATCTGAAGATCATCGGTGGATTTTGGAGCACAAGGAGGTGA
CTAATTTTGAGGTGAGGAGGTATCTAGCCATGATGATGCTTCCAGAAGTGAAGGACGAGTACGAGGAGCTACACGAGATGCTCATTGACC
GCGCTCAGTTGCTCTCAGAATCTTTTGAGTACATTGCACATGCAGATCCTGAGTCATTACGTGGTGGTTTGTTTATGGAGTTCAAGAGTG
AAGAAGCTACGGGGCCTGGXCGTCTTGAGGGAGTGGTTTTTCTTGGTATGTCGAGCAATCTTCAACCCTCAGAAcGCACTGTTTGTTGCT
TGTCCAAATGACCGCAGAAGGTTCTTTCCAAATCCAGCGTCGAAGGTGGACCCGTTGCACCTTGAGTATTTTAGCTTCTCTGGCAGGGTA
ATTGCTTTGGCCTTAATGCATAAAATACAAGTCGGCATTGTCTTTGACCGCGTGTTCTTCTTACAATTGTCGGGCAAGAGTATTTCCTTG
GATGACATAAGGGATGCAGATCCATTCTTGTACAGCAGCTGCAGGCAGATATTGGAGATGGATCCGGAGATGGTAGATCAAGATACTCTT
GGTTTGACATTTGTTCGTGAAGTAGAAGAGTTAGGATCCAGGAAGGTTGTCGAGCTGTGCCCTAATGGGAAAAGTACCATGGTGAATAGT
AAAAATAGGAAGCAGTATGTTGAGCTTCTTATTCAGCACCGCTTTGTCACATCCATTGCTGAGCAGGTAGCTCATTTTGCTCAAGGTTTT
GCTGACATTXATAACCTCCGTAAGGCTCCAGAAATCCTTTTTCCAGAGCTTAAAtCTTGAAGATCTTGATTGGATGCTCCACGGGAGTGA
AACTGCTGTTTCTGTGGAAGACTGGAAAGCACATACTGATTATAATGGCTATAAAGAAAGTGATCCTCAAATATCTTGGTTTTGGAAGAT
TGTTGGGTGCATGACAGCTGAGCAGAGAAAGGTTCTCCTCTTCTTTTGGACTTCAATAAAGTATCTTCCCGTCGAGGGTTTTGGAGGTTT
GGCCTCTAGGCTTTACATCTACAAAACCAGAGAGTCAAATGATCGTTTGCCTTCTTCACACACGTGCTTCTTCCGCCTATGCTTTCCTCC
TTATCCATCCATGGATGCCATGCAAGATCGACTTCACATTATCACCCAAGAGCATGTAGGTTGCAGCTTTGGTACgTGGTAACATCATCG
ATCTTTTTGGACCTGAATCAGACTGCACATAA(3')GTTATGTAATCAACTTGTACATATGTATAGCGTATGCTCCTATCTGGAACTTGA
CTTTGGTAAGTTTTTTTCTAGTTGGTTTAAATGGTGGAAGGTTGTAGTTTATTCTCCACCTTAATTTAACTTTTATACGAGGTATAATAT
CTGTTAATAAAAANAAATGTAAGAAGGAGTCAAGTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan