ESTScan Details for Unigene SGN-U582187

Score 
1189
Direction 
Forward
Predicted Peptide Sequence 
MAAADAGGGTYSDNLWVQEFDGNSAIDVHKAEGRPLNVPLIAPFTIASSRLDKVENVAIRVELSNGCVGWGEAPILPFVTAEDQSIALAK
AAEACEFLKQSREMTLNVALTKIGDVLPGHDFASVRAGVEMALIDAAATALEYLSGDYXGGVSNAISTDITIPIVSPMEASELASKYRKQ
GFKTLKLKVGKNLNGDIEVLQSIRAAHPDCLFILDANEGYTANEAIKVLEKLHEMDVTPVLFEQPVHRDDWKGLGHVSQIAKDKYGVSVA
ADESCRSLVDAKKIVQESLADVINIKLAKVGVLGALEIIXLGEVLGLKSDDGGMVETRLAMGFAGHLAAGLGCFKFIDLDTPLLLAEDPV
FGGYEASGPDYSFSNARGHGGFLHWENIAMILVAELVHSSGLSLTT*
Predicted Coding Sequence 
ATGGCGGCAGCXGACGCCGGCGGTGGCACCTACAGCGACAACCTTTGGGTTCAAGAATTTGATGGAAACAGTGCAATTGATGTTCATAAA
GCGGAAGGGAGGCCACTGAACGTGCCACTGATTGCTCCTTTTACTATTGCATCATCAAGATTGGACAAAGTGGAAAACGTAGCTATTAGG
GTTGAGTTGAGTAATGGCTGTGTTGGGTGGGGTGAAGCCCCAATTCTTCCATTTGTGACTGCAGAGGATCAATCCATTGCCTTAGCAAAA
GCGGCTGAAGCCTGTGAGTTCTTGAAGCAGAGCCGTGAAATGACTTTAAATGTTGCATTAACAAAAATTGGCGACGTGCTCCCTGGACAT
GATTTTGCTTCTGTCAGGGCAGGAGTTGAGATGGCACTGATTGATGCAGCAGCAACAGCATTGGAATACCTCTCTGGAGACTATXTTGGT
GGAGTATCTAATGCAATATCTACTGACATTACAATTCCGATTGTTTCACCCATGGAAGCTTCTGAACTGGCTTCAAAGTATCGTAAACAA
GGTTTCAAGACTTTAAAGCTTAAGGTGGGCAAGAATTTGAACGGAGACATTGAAGTGCTTCAATCCATACGTGCAGCACATCCTGATTGC
TTGTTTATCTTAGATGCTAATGAAGGTTACACGGCAAATGAAGCTATTAAAGTCCTGGAAAAGTTGCATGAAATGGATGTCACTCCGGTG
CTATTTGAACAACCTGTTCATAGAGATGATTGGAAAGGTCTTGGTCATGTCAGTCAGATTGCAAAGGACAAATATGGGGTATCTGTTGCT
GCCGATGAAAGTTGTCGAAGTTTGGTTGATGCTAAAAAGATAGTGCAAGAAAGTCTTGCTGATGTCATTAACATTAAGCTTGCCAAAGTT
GGGGTGCTTGGGGCTCTGGAAATTATTGXACTTGGTGAGGTCCTCGGGCTTAAATCTGATGATGGTGGTATGGTTGAAACCAGGCTTGCC
ATGGGCTTTGCTGGTCATCTAGCCGCTGGCCTTGGATGTTTCAAATTCATTGACCTAGACACACCCCTTCTGTTGGCAGAAGATCCAGTT
TTTGGGGGTTATGAAGCTTCTGGACCTGATTACAGCTTCTCAAATGCTAGAGGGCACGGTGGTTTTCTTCATTGGGAGAATATTGCXATG
ATATTAGTAGCGGAGCTTGTTCACTCTTCAGGATTGTCACTCACAACCTAA
Edits in Original Sequence 
GTCAGCAGAGGACAAGTATAAGAACAAAGTTTCGATAATCGCTATGACATTTTTTTTTTCAAATCTTCCCTTTTCTGTCCAAAAGCCAAT
CAGTGAAGCTCAAATTCACTATTTACTGCAATTCATAGAAGATGGATCGTATTGGGCTTACTCAAAACTTCCAAACTCACTGTTTCTTTC
ATTTTACTGCTTCTTTACGCACCCAATTGTCTAAAGTTTCTAACTTTACCCCCAATTTCAAGAATCCCAAAGTTGTTACAGCCTGC
(5')
ATGGCGGCAGCXGACGCCGGCGGTGGCACCTACAGCGACAACCTTTGGGTTCAAGAATTTGATGGAAACAGTGaCAATTGATGTTCATAA
AGCGGAAGGGAGGCCACTGAACGTGCCACTGATTGCTCCTTTTACTATTGCATCATCAAGATTGGACAAAGTGGAAAACGTAGCTATTAG
GGTTGAGTTGAGTAATGGCTGTGTTGGGTGGGGTGAAGCCCCAATTCTTCCATTTGTGACTGCAGAGGATCAATCCATTGCCTTAGCAAA
AGCGGCTGAAGCCTGTGAGTTCTTGAAGCAGAGCCGTGAAATGACTTTAAATGTTGCATTAACAAAAATTGGCGACGTGCTCCCTGGACA
TGATTTTGCTTCTGTCAGGGCAGGAGTTGAGATGGCACTGATTGATGCAGCAGCgAACAGCATTGGAATACCTCTCTGGAGACTATXTTG
GTGGAGTATCTAATGCAATATCTACTGACATTACAATTCCGATTGTTTCACCCATGGAAGCTTCTGAACTGGCTTCAAAGTATCGTAAAC
AAGGTTTCAAGACTTTAAAGCTTAAGGTGGGCAAGAATTTGAACGGAGACATTGAAGTGCTTCAATCCATACGTGCAGCACATCCTGATT
GCTTGTTTATCTTAGATGCTAATGAAGGTTACACGGCAAATGAAGCTATTAAAGTCCTGGAAAAGTTGCATGAAATGGATGTCACTCCGG
TGCTATTTGAACAACCTGTTCATAGAGATGATTGGAAAGGTCTTGGTCATGTCAGTCAGATTGCAAAGGACAAATATGGGGTATCTGTTG
CTGCCGATGAAAGTTGTCGAAGTTTGGTTGATGCTAAAAAGATAGTGCAAGAAAGTCTTGCTGATGTCATTAACATTAAGCTTGCCAAAG
TTGGGGTGCTTGGGGCTCTGGAAATTATTGXACTTGGTGAGGTCCTCGGGCTTAAATCTGATGATcGGTGGTATGGTTGAAACCAGGCTT
GCCATGGGCTTTGCTGGTCATCTAGCCGCTGGCCTTGGATGTTTCAAATTCATTGACCTAGACACACCCCTTCTGTTGGCAGAAGATCCA
GTTTTTGGGGGTTATGAAGCTTCTGGACCTGATTACAGCTTCTCAAATGCTAGAGGGCACGGTGGTTTTCTTCATTGGGAGAATATTGCX
ATGATATTAGTAGCGGAGCTTGTTCACTCTTCAGGATTGTCACTCACAACCTAA(3')TTATAGTTATGCATATGTACTTGTGAATTAGT
CGTTGGTAAATTTGAAATGTTTATGTGCCAAAGAATTGGAACACAATGCTAGAATATCCAATCTTTAGAGTAAACAAATATGTAAATGTC
TTATTGTCTGTTGAAATTGATGTTAGTTGAGAACGTCTTGCTTGATCTTCTCTTTGACAATCTCAACAAATATTAAATCAATCTGCCAGA
CTCTTGGTACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan