ESTScan Details for Unigene SGN-U582267

Score 
1645
Direction 
Forward
Predicted Peptide Sequence 
XSHTTSSSSSSSAALLFSKSLRPNFFHHLKNPFSYPIQPNRRRALFSSSPSMESAAVTVESVADKLKKQSLGNDGSNSKRLLKLEELNWD
HSFVRELPADPRTDTIPREVLHACYTKMLPSVEVENPQLVVWSDSVAELLELDPKEFERPDFPLLFSGASPLVGAVPYAQNYGGHQFGMW
AGQLGDGRAITLGEVLNSKSERWELQLKGAGKTPYSRFADGLAVLRSSIREFLCSEAMHSLGIPTTRALCLVMTGKDVSRDMFYDGNPKD
EPGAIAAELLNPFFALALTNYMPLGGKEDLEIVRTLADYTIRHHFPHLENMCKSESISFSIGEEDDTVVDLTSNKYAAWAVEVAEQTAST
IARWQGVGFTHGVMNTDNMSVLGLTIDYGPFGFLDAFDPSFTPNTTDLPGRRYCFANQPDIGLWNVAQFATSLSTAQLLNDKEANYAIER
YGIKFMDDYQAIMTKKLGLVKYNKQMIGELLKNMAVDKVDYTNFFRLLSNIKADPTIPDNQLLIPLKAALLDIGQERKEAWTSWVKSYIQ
ELSTIGVSDDERKASMNSVNPKYILRNYLCQSAIDAAEQDDFGEVRRLLKVMQRPFDEQPGMEKYARLPPAWAYRPGVGMLSCSS*
Predicted Coding Sequence 
XTCTCTCATACTACTTCTTCTTCTTCTTCTTCCTCTGCCGCTCTTCTCTTCTCCAAATCTCTTCGACCCAATTTTTTTCATCACCTAAAG
AACCCCTTTTCATACCCAATTCAGCCCAATCGCCGCCGTGCGTTGTTTTCTTCTTCACCGTCAATGGAATCAGCTGCTGTGACGGTTGAG
TCAGTTGCTGACAAATTGAAGAAGCAGAGTTTGGGAAATGATGGAAGTAACAGTAAACGTTTGTTGAAACTTGAAGAGCTCAATTGGGAT
CATTCATTTGTTCGTGAACTGCCTGCTGATCCAAGAACAGATACCATTCCAAGAGAGGTATTGCATGCATGCTATACGAAAATGTTGCCT
TCTGTTGAGGTGGAGAATCCTCAGCTCGTTGTGTGGTCAGACTCAGTAGCTGAGTTACTTGAGTTGGATCCTAAAGAATTTGAGAGGCCT
GATTTTCCACTTCTGTTCTCAGGGGCATCACCTTTAGTTGGAGCTGTGCCTTATGCCCAGAACTATGGAGGACATCAGTTTGGGATGTGG
GCTGGTCAGCTAGGTGATGGTCGAGCAATAACTCTTGGAGAGGTTTTGAATTCAAAGTCTGAAAGATGGGAGCTGCAGCTAAAGGGTGCA
GGGAAGACCCCATATAGCCGTTTTGCTGATGGTCTTGCAGTTCTTCGGAGTAGTATCCGGGAGTTCCTCTGCAGCGAAGCAATGCATAGT
CTTGGAATCCCAACTACAAGAGCACTCTGTCTTGTGATGACAGGAAAAGATGTCAGCAGGGACATGTTTTACGACGGGAATCCAAAGGAT
GAGCCTGGTGCCATTGCTGCAGAGTTGCTGAATCCTTTCTTCGCTTTGGCTCTTACCAACTACATGCCTCTAGGXGGTAAAGAGGACCTT
GAGATTGTGCGTACTTTAGCAGATTACACAATTAGACATCATTTCCCCCATCTAGAGAACATGTGTAAGAGCGAAAGCATATCATTCAGC
ATAGGCGAGGAAGATGATACGGTTGTGGATTTAACTTCAAACAAATATGCAGCATGGGCAGTGGAAGTTGCAGAGCAGACTGCTTCCACA
ATTGCGAGGTGGCAAGGTGTTGGTTTCACACACGGAGTGATGAATACCGATAACATGAGTGTGTTAGGCCTCACCATTGATTATGGCCCT
TTTGGATTTTTAGACGCGTTTGATCCCAGTTTCACACCCAATACCACTGATCTACCTGGCAGAAGATACTGCTTTGCGAATCAGCCGGAT
ATAGGTTTATGGAATGTTGCTCAGTTTGCTACTTCTCTATCTACTGCACAGTTGCTAAATGATAAGGAGGCAAATTATGCCATAGAGAGG
TATGGCATCAAATTTATGGATGACTATCAAGCTATCATGACCAAAAAGCTTGGTTTGGTCAAGTACAATAAACAAATGATTGGTGAACTA
CTTAAGAATATGGCTGTCGATAAAGTTGATTACACAAACTTCTTCCGATTACTATCAAACATCAAAGCCGATCCTACAATTCCAGATAAC
CAGTTACTGATTCCTCTCAAAGCTGCGCTATTGGATATTGGTCAGGAGCGCAAGGAAGCTTGGACAAGCTGGGTGAAATCCTACATACAG
GAGCTCTCTACTATCGGTGTATCAGACGATGAGAGGAAGGCCTCGATGAATTCTGTTAATCCAAAGTACATCCTTAGAAACTATTTATGC
CAAAGTGCAATAGATGCAGCTGAACAAGACGATTTTGGGGAGGTCAGACGACTACTGAAAGTCATGCAACGTCCATTTGACGAACAACCT
GGCATGGAGAAGTATGCGCGTCTGCCTCCAGCTTGGGCTTATCGTCCCGGTGTAGGCATGCTTTCATGTTCCTCATAA
Edits in Original Sequence 
(5')XTCTCTCATACTACTTCTTCTTCTTCTTCTTCCTCTGCCGCTCTTCTCTTCTCCAAATCTCTTCGACCCAATTTTTTTCATCACCT
AAAGAACCCCTTTTCATACCCAATTCAGCCCAATCGCCGCCGTGCGTTGTTTTCTTCTTCACCGTCAATGGAATCAGCTGCTGTGACGGT
TGAGTCAGTTGCTGACAAATTGAAGAAGCAGAGTTTGGGAAATGATGGAAGTAACAGTAAACGTTTGTTGAAACTTGAAGAGCTCAATTG
GGATCATTCATTTGTTCGTGAACTGCCTGCTGATCCAAGAACAGATACCATTCCAAGAGAGGTATTGCATGCATGCTATACGAAAATGTT
GCCTTCTGTTGAGGTGGAGAATCCTCAGCTCGTTGTGTGGTCAGACTCAGTAGCTGAGTTACTTGAGTTGGATCCTAAAGAATTTGAGAG
GCCTGATTTTCCACTTCTGTTCTCAGGGGCATCACCTTTAGTTGGAGCTGTGCCTTATGCCCAGAACTATGGAGGACATCAGTTTGGGAT
GTGGGCTGGTCAGCTAGGTGATGGTCGAGCAATAACTCTTGGAGAGGTTTTGAATTCAAAGTCTGAAAGATGGGAGCTGCAGCTAAAGGG
TGCAGGGAAGACCCCATATAGCCGTTTTGCTGATGGTCTTGCAGTTCTTCGGAGTAGTATCCGGGAGTTCCTCTGCAGCGAAGCAATGCA
TAGTCTTGGAATCCCAACTACAAGAGCACTCTGTCTTGTGATGACAGGAAAAGATGTCAGCAGGGACATGTTTTACGACGGGAATCCAAA
GGATGAGCCTGGTGCCATTGtCTGCAGAGTTGCTGAATCCTTTCTTCGCTTTGGCTCTTACCAACTACATGCCTCTAGGXGGTAAAGAGG
ACCTTGAGATTGTGCGTACTTTAGCAGATTACACAATTAGACATCATTTCCCCCATCTAGAGAACATGTGTAAGAGCGAAAGCATATCAT
TCAGCATAGGCGAGGAAGATGATACGGTTGTGGATTTAACTTCAAACAAATATGCAGCATGGGCAGTGGAAGTTGCAGAGCAGACTGCTT
CCACAATTGCGAGGTGGCAAGGTGTTGGTTTCACACACGGAGTGATGAATACCGATAACATGAGTGTGTTAGGCCTCACCATTGATTATG
GCCCTTTTGGATTTTTAGACGCGTTTGATCCCAGTTTCACACCCAATACCACTGATCTACCTGGCAGAAGATACTGCTTTGCGAATCAGC
CGGATATAGGTTTATGGAATGTTGCTCAGTTTGCTACTTCTCTATCTACTGCACAGTTGCTAAATGATAAGGAGGCAAATTATGCCATAG
AGAGGTATGGCATCAAATTTATGGATGACTATCAAGCTATCATGACCAAAAAGCTTGGTTTGGTCAAGTACAATAAACAAATGATTGGTG
AACTACTTAAGAATATGGCTGTCGATAAAGTTGATTACACAAACTTCTTCCGATTACTATCAAACATCAAAGCCGATCCTACAATTCCAG
ATAACCAGTTACTGATTCCTCTCAAAGCTGCGCTATTGGATATTGGTCAGGAGCGCAAGGAAGCTTGGACAAGCTGGGTGAAATCCTACA
TACAGGAGCTCTCTACTATCGGTGTATCAGACGATGAGAGGAAGGCCTCGATGAATTCTGTTAATCCAAAGTACATCCTTAGAAACTATT
TATGCCAAAGTGCAATAGATGCAGCTGAACAAGACGATTTTGGGGAGGTCAGACGACTACTGAAAGTCATGCAACGTCCATTTGACGAAC
AACCTGGCATGGAGAAGTATGCGCGTCTGCCTCCAGCTTGGGCTTATCGTCCCGGTGTAGGCATGCTTTCATGTTCCTCATAA(3')ATT
CTCTCTACTATATAATACAAGATATTAACTTGTATATGCATTAGAAATTTTAGCTTAAAAGTTCTTGTAGTAATGTGTAAAAGGTATAGC
TATTCTCTTTTTATACCGCCTTTTTTTTTTTCGGAGGGTGGGGTGCGGGTAAGGATGGGGGTGGGTTTGTAGCATTTCTACGCGTATTTT
GCGTGAGAAATACATTTTTTTGCGAGTTCCATACCAATATAAATTCAATTAGCTTGTTTGTTTTGAGCATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan