ESTScan Details for Unigene SGN-U582281

Score 
721
Direction 
Forward
Predicted Peptide Sequence 
MDFGVYVDGFFLYLATVGSILPGKLVPGATLSDGTRLHYRCNGLLSLLLLVLLLGVGSQMNLVSPTAIADRGLELLSTTLIFSVLVTLML
YLVGLNSRAKSSSLKPHVSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCVIEAKLSQSMILYQLFCGLYILDYFF
YEEFMTSTWDIIAERLGYMLVFGDLVFIPFTFSIQGWWLLSNKVELTTAAIIANCLVFLIGYSVFRGANKQKHVFKKDPKAPIWGSPPKV
IGGKLLASGYWGIARHCNYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLVPYXDLTLRLLAQS
FVHVACALESELASLYRTTQA*
Predicted Coding Sequence 
ATGGACTTCGGTGTCTATGTTGATGGATTTTTTCTCTATTTAGCTACCGTTGGATCTATTCTACCCGGAAAACTTGTTCCTGGGGCGACT
TTATCTGATGGAACTCGACTCCATTATCGTTGCAATGGTTTATTATCACTTCTGTTGTTGGTTTTGCTTCTTGGAGTTGGGTCGCAGATG
AATCTTGTTTCACCTACTGCTATAGCAGATAGAGGACTTGAGCTTTTGTCCACAACACTTATCTTTAGTGTTCTTGTGACATTGATGCTT
TATTTGGTTGGCCTGAACTCACGTGCAAAGAGTTCATCACTGAAACCTCATGTCTCAGGAAATCTAATCCATGACTGGTGGTTTGGGATA
CAACTGAATCCTGAATTCATGGGCATTGATCTCAAATTTTTCTTTGTTAGAGCTGGTATGATGGGATGGTTACTTATCAATCTTTCAGTT
CTTGCAAAATGTGTTATAGAGGCTAAATTGAGCCAATCAATGATTCTCTACCAGCTATTTTGTGGGCTCTACATCCTTGACTACTTCTTC
TATGAAGAGTTCATGACCTCCACATGGGATATAATAGCAGAGAGGTTGGGCTACATGCTGGTTTTTGGTGATCTAGTCTTTATACCGTTC
ACCTTCAGTATTCAGGGTTGGTGGCTTTTGAGTAACAAAGTGGAGCTAACAACAGCAGCAATAATTGCCAATTGCCTCGTCTTTCTTATT
GGGTACTCGGTGTTCAGAGGAGCCAATAAGCAGAAGCATGTATTTAAAAAGGATCCCAAGGCACCCATATGGGGTAGTCCTCCAAAAGTT
ATTGGGGGAAAGTTGCTTGCTTCTGGCTATTGGGGCATTGCACGGCACTGTAATTACCTCGGGGATTTGTTGCTGGCATCGTCTTTTAGT
TTACCTTGTGGTATAAGCTCTGTGGTTCCATACTTTTACCCCATATATCTTCTCATTCTACTCATATGGAGGGAGAGAAGGGACGAAGCT
AGATGTGCAGAGAAGTACAAAGATGTGTGGGCTGAATACCGTAAACTTGTTCCTTACAXGGATCTTACCTTACGTTTACTAGCTCAATCG
TTTGTCCACGTTGCTTGTGCATTAGAGTCAGAATTAGCCTCACTGTACCGCACTACCCAAGCATGA
Edits in Original Sequence 
CACCTTTAAACATATACTGATACTGAACTTGAACCTTCAATATCTGCTAATGGATCTCAATAATCTCTTCATTTCTCTCACTCCATC(5')
ATGGACTTCGGTGTCTATGTTGATcGGATTTTTTCTCTATTTAGCTACCGTTGGATCTATTCTACCCGGAAAACTTGTTCCTGGGGCGA
CTTTATCTGATGGAACTCGACTCCATTATCGTTGCAATGGTTTATTATCACTTCTGTTGTTGGTTTTGCTTCTTGGAGTTGGGTCGCAGA
TGAATCTTGTTTCACCTACTGCTATAGCAGATAGAGGACTTGAGCTTTTGTCCACAACACTTATCTTTAGTGTTCTTGTGACATTGATGC
TTTATTTGGTTGGCCTGAACTCACGTGCAAAGAGTTCATCACTGAAACCTCATGTCTCAGGAAATCTAATCCATGACTGGTGGTTTGGGA
TACAACTGAATCCTGAATTCATGGGCATTGATCTCAAATTTTTCTTTGTTAGAGCTGGTATGATGGGATGGTTACTTATCAATCTTTCAG
TTCTTGCAAAATGTGTTATAGAGGCTAAATTGAGCCAATCAATGATTCTCTACCAGCTATTTTGTGGGCTCTACATCCTTGACTACTTCT
TCTATGAAGAGTTCATGACCTCCACATGGGATATAATAGCAGAGAGGTTGGGCTACATGCTGGTTTTTGGTGATCTAGTCTTTATACCGT
TCACCTTCAGTATTCAGGGTTGGTGGCTTTTGAGTAACAAAGTGGAGCTAACAACAGCAGCAATAATTGCCAATTGCCTCGTCTTTCTTA
TTGGGTACTCGGTGTTCAGAGGAGCCAATAAGCAGAAGCATGTATTTAAAAAGGATCCCAAGGCACCCATATGGGGTAGTCCTCCAAAAG
TTATTGGGGGAAAGTTGCTTGCTTCTGGCTATTGGGGCATTGCACGGCACTGTAATTACCTCGGGGATTTGTTGCTGGCATCGTCTTTTA
GTTTACCTTGTGGTATAAGCTCTGTGGTTCCATACTTTTACCCCATATATCTTCTCATTCTACTCATATGGAGGGAGAGAAGGGACGAAG
CTAGATGTGCAGAGAAGTACAAAGATGTGTGGGCTGAATACCGTAAACTTGTTCCTTACAXGGATCTTACCTTACGTTTACTAGCTCAAT
CGTTTGTCCACGTTGCTTGTGCATTAGAGTCAGAATTAGCCTCACTGTACCGCACTACCCAAGCATGA(3')GAAGGGACGAACTCATGA
ATGAATATTACATCAAATTCGAGCTTTTGCCCTATCTATGCAGCTTTCTCATCTCCTCTACGAAAGTAATCTTTTAATCTATTTCAGTTA
GGATCAACACTGTATCCAGGTTGTAACTGATTGCTTAGCTTTTGAAAGTTTTTCCAGAACCAACTTGTACACTAGATGTACTTTATCATG
GCAGGATTTAAATGTGCTGCTTGTATTGAATGCCAACTATGGAATTATTTTTCATGGTTTGTAATCTTGGAGCAGCTTACTAATGTGTGC
TGAAATTTTCGAATGATTTTCCCGACTTTCTAGTTTTTTGTATGCCCCTTGACTAATTTCAGGAGATATTTGCTACGTTCCCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan