ESTScan Details for Unigene SGN-U582604

Score 
1076
Direction 
Forward
Predicted Peptide Sequence 
MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVLSSDGMFALSGSWDGELRL
WDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWN
LTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSIVV
DLKVDLKHESEMANESGTAPKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY*
Predicted Coding Sequence 
ATGGCGCAAGAATCACTTGTCCTTCGCGGCACCATGAAAGCCCACACCGATTGGGTCACTGCCATCGCCACCCCAATTGATAACTCTGAC
ATGATTGTTACTTCCTCCAGGGACAAGTCCATCATTGTCTGGTCTCTCACCAAGGATGGCGCACAGTACGGTGTCCCCCGCCGCCGTCTC
ACAGGCCACGGCCACTTTGTTCAGGATGTTGTTCTCTCCTCCGACGGTATGTTTGCTCTCTCTGGTTCTTGGGATGGAGAGCTTCGCCTT
TGGGATCTTCAAGCCGGCACTACTGCTCGCCGTTTTGTTGGTCACACTAAGGATGTTCTCTCCGTTGCTTTTTCCGTTGATAACCGTCAG
ATTGTGTCCGCTTCACGGGACAAGTCTATCAAGTTGTGGAACACTCTCGGTGAGTGTAAATACACCATTCAGGACGGAGACTCACACTCC
GATTGGGTTTCGTGTGTGCGTTTCAGCCCAAACACTCTCCAGCCAACTATTGTTTCTGGTTCCTGGGATCGTACTGTGAAAATCTGGAAC
CTCACCAACTGTAAGCTGCGTTCGACTCTTGCTGGACACTCTGGCTATGTGAACACTGTGGCAGTGTCACCTGATGGTTCCTTGTGCGCT
AGTGGTGGCAAGGATGGAGTTATTTTGCTCTGGGATTTGGCTGAGGGGAAGAAGCTCTACTCCCTTGACGCTGGCTCCATCATTCATACT
CTCTGCTTTAGTCCTAACAGGTACTGGCTCTGCGCAGCCACCGAGTCTAGCATTAAGATTTGGGACTTGGAGAGCAAGAGCATCGTGGTT
GACCTTAAAGTTGATCTCAAGCATGAGAGTGAGATGGCTAACGAGAGTGGAACTGCACCAAAAACCAAGGTCATTTACTGTACCAGTTTG
AGTTGGAGTGCTGATGGAAGCACACTTTTCAGCGGATATACAGATGGTTTGATTAGGGTTTGGGGTATTGGGCGTTACTAG
Edits in Original Sequence 
GAAAGGTTAGGGTTTCTCTTCACTGCTGTATCGTCGTCTCACTTGCCTTTCAGAGGATAACCGGAGCGGCGACCACCTTGCTTGACAAA
(5')ATGGCGCAAGAATCACTTGTCCTTCGCGGCACCATGAAAGCCCACACCGATTGGGTCACTGCCATCGCCACCCCAATTGATAACTCT
GACATGATTGTTACTTCCTCCAGGGACAAGTCCATCATTGTCTGGTCTCTCACCAAGGATGGCGCACAGTACGGTGTCCCCCGCCGCCGT
CTCACAGGCCACGGCCACTTTGTTCAGGATGTTGTTCTCTCCTCCGACGGTATGTTTGCTCTCTCTGGTTCTTGGGATGGAGAGCTTCGC
CTTTGGGATCTTCAAGCCGGCACTACTGCTCGCCGTTTTGTTGGTCACACTAAGGATGTTCTCTCCGTTGCTTTTTCCGTTGATAACCGT
CAGATTGTGTCCGCTTCACGGGACAAGTCTATCAAGTTGTGGAACACTCTCGGTGAGTGTAAATACACCATTCAGGACGGAGACTCACAC
TCCGATTGGGTTTCGTGTGTGCGTTTCAGCCCAAACACTCTCCAGCCAACTATTGTTTCTGGTTCCTGGGATCGTACTGTGAAAATCTGG
AACCTCACCAACTGTAAGCTGCGTTCGACTCTTGCTGGACACTCTGGCTATGTGAACACTGTGGCAGTGTCACCTGATGGTTCCTTGTGC
GCTAGTGGTGGCAAGGATGGAGTTATTTTGCTCTGGGATTTGGCTGAGGGGAAGAAGCTCTACTCCCTTGACGCTGGCTCCATCATTCAT
ACTCTCTGCTTTAGTCCTAACAGGTACTGGCTCTGCGCAGCCACCGAGTCTAGCATTAAGATTTGGGACTTGGAGAGCAAGAGCATCGTG
GTTGACCTTAAAGTTGATCTCAAGCATGAGAGTGAGATGGCTAACGAGAGTGGAACTGCACCAAAAACCAAGGTCATTTACTGTACCAGT
TTGAGTTGGAGTGCTGATGGAAGCACACTTTTCAGCGGATATACAGATGGTTTGATTAGGGTTTGGGGTATTGGGCGTTACTAG(3')GA
ATTGCATCTAGGCAAGCTTTTTGGCTATAGTCTCCATTAAAGACGTTTAGATTGTCCTTGAAAATGTATCTGGATTCTCTTTGTTTCTCA
TGAGTTTGAGAGTTTTGATGTTCCATTTTTGGAATTCTGTTTAGAATTTCGTTACAAGCTTGTGTTGCTGTTATTCCTCCCGGGCTGGTT
ATGTTTTCAATGCTTTGACCTAATACATGGTTGGATAAGAACCTGCAAGTCACCGTTTTGAATTCATATTCATTGTCCTACTAGTGAAGT
TATTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan