ESTScan Details for Unigene SGN-U582646

Score 
499
Direction 
Forward
Predicted Peptide Sequence 
MATITAGISLRGPVVGGYRTFAVTKRALPKVKFSSELSFVTSQLSGIKISSTHLSSPASLSVPFKTALQPVARRVCPFTGKKSXQGKQGL
SFKPQNEKVAIRKPSIQENLVGGRQTIRETEVVNKGQKTIEKNGLDAVAKKAGIDXQQEVEPGT*
Predicted Coding Sequence 
ATGGCGACAATCACAGCGGGTATAAGCCTCAGAGGACCAGTAGTGGGTGGTTACAGGACATTTGCAGTGACCAAAAGGGCTTTACCCAAG
GTGAAATTCAGCTCAGAGTTGAGTTTTGTGACTTCTCAATTGAGTGGCATCAAGATTTCAAGCACCCATTTGAGCTCTCCTGCTTCACTT
TCTGTTCCTTTCAAGACAGCCCTTCAACCTGTTGCTCGTAGAGTATGCCCCTTCACTGGCAAGAAGTCCAAXCAGGGCAAACAAGGTCTC
TCATTCAAACCACAAAACGAAAAAGTTGCAATTCGTAAACCTTCAATACAAGAGAATTTGGTGGGAGGAAGGCAAACGATTCGTGAAACT
GAGGTTGTCAACAAAGGCCAAAAGACCATTGAGAAAAATGGACTTGATGCTGTAGCCAAGAAAGCTGGGATTGATXCTCAGCAAGAAGTA
GAACCTGGAACCTGA
Edits in Original Sequence 
ACGTTCCCGAAATGGATCCTATCAAATATTTCACATTTTCTAAAAAAAAAGCAACATTCTTGAGACAAAAAAGATTCTTGCTTTGAGGAA
TTGGTTGCAAAA
(5')ATGGCGACAATCACAGCGGGTATAAGCCTCAGAGGACCAGTAGTGGGTGGTTACAGGACATTTGCAGTGACCAA
AAGGGCTTTACCCAAGGTGAAATTCAGCTCAGAGTTGAGTTTTGTGACTTCTCAATTGAGTGGCATCAAGATTTCAAGCACCCATTTGAG
CTCTCCTGCTTCACTTTCTGTTCCTTTCAAGACAGCCCTTCAACCTGTTGCTCGTAGAGTATGCCCCTTCACTGGCAAGAAGTCCAAXCA
GGGCAAACAAGGTCTCTCATTCAAACCACAAAACGAAAAAGTTGCAATTCGTAAACCTTCAATACAAGAGAATTTGGTGGGAGGAAGGCA
AACGATTCGTGAAACTGAGGTTGTCAACAAAGGCCAtAAAGACCATTGAGAAAAATGGACTTGATGCTGTAGCCAAGAAAGCTGGGATTG
ATXCTCAGCAAGAAGTAGAACCTGGAACCTGA(3')TAGCATATTTGTTTGGACACTAATTTTGATGCCCTCAAAAACCATAACTTTATT
TTTTGGCATTGCTTGTTGATTTGTAGTTATATGTTTTCATGATATTACTCTCCAAGCATATCTTGATCACCTACTTTCAATGAATATCAA
CATCATTCTCTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan