ESTScan Details for Unigene SGN-U582789

Score 
822
Direction 
Forward
Predicted Peptide Sequence 
SPSSFGPTAXALVLHHVRSLPSSSSLLLPPFTLILPILHENEESDTPIHRFQQYLRINTAHPNPNYTAAINYLTNFANSIPNLHSKIIHL
TPTSPLLLLTWPGSNPSLPSILFNSHLDSVPAEPHKWTHPPFSAHKTSDGRIFARGAQDDKCIGMQYLEAIKAIQMSDSKFVPLRNVHIL
YVPEEEVGGFDGMGKFVESKEFGELNLGFVMDEGQASPNDEFRVFYADRTPWHTVIKAVGMPGHGSKLYDNSAMENLMKSMEVITKFRES
MFDMVKAGVAANSEVISVNPVFLNAGTPSPX
Predicted Coding Sequence 
AGTCCTTCTTCATTTGGTCCAACTGCAXTAGCACTTGTTCTTCACCATGTTCGATCACTTCCATCGTCTTCCAGTCTTCTTCTTCCTCCT
TTCACTCTCATTCTCCCAATCCTCCATGAAAACGAAGAATCAGACACACCCATTCACCGTTTTCAACAATATCTCAGAATCAACACTGCC
CATCCTAACCCAAACTACACTGCCGCCATTAACTACCTCACTAACTTCGCCAACTCCATCCCTAATCTCCACTCCAAAATCATTCACCTT
ACCCCTACTTCGCCTCTCCTCCTATTAACCTGGCCAGGTTCAAACCCTTCACTCCCCTCCATTCTTTTCAATTCCCATCTTGATTCTGTC
CCTGCTGAACCACATAAATGGACCCACCCGCCGTTTTCCGCTCACAAGACTTCCGATGGAAGAATATTTGCACGGGGAGCGCAGGATGAT
AAGTGTATTGGTATGCAGTATTTGGAAGCAATCAAAGCGATTCAAATGAGTGATTCAAAATTTGTGCCACTGAGAAATGTTCATATTCTG
TATGTGCCTGAAGAGGAGGTTGGTGGGTTTGATGGGATGGGGAAGTTTGTGGAGTCGAAAGAATTTGGAGAGTTGAATCTTGGGTTTGTG
ATGGATGAAGGACAGGCCTCGCCTAATGATGAGTTTAGGGTTTTTTATGCTGATAGGACTCCTTGGCATACGGTGATTAAGGCTGTTGGA
ATGCCTGGACATGGGTCTAAATTGTATGATAATTCTGCTATGGAGAATTTGATGAAGAGTATGGAGGTTATTACTAAGTTTAGGGAGTCT
ATGTTTGATATGGTCAAAGCTGGAGTGGCTGCTAATTCTGAGGTCATCTCAGTGAACCCGGTGTTTCTTAATGCTGGAACTCCTTCCCCA
AXX
Edits in Original Sequence 
(5')AGTCCTTCTTCATTTGGTCCAACTGCAXTAGCACTTGTTCTTCACCATGTTCGATCACTTCCATCGTCTTCCAGTCTTCTTCTTCC
TCCTTTCACTCTCATTCTCCCAATCCaTCCATGAAAACGAAGAATCAGACACACCCATTCACCGTTTTCAACAATATCTCAGAATCAACA
CTGCCCATCCTAACCCAAACTACACTGCCGCCATTAACTACCTCACTAACTTCGCCAACTCCATCCCTAATCTCCACTCCAAAATCATTC
ACCTTACCCCTACTTCGCCTCTCCTCCTATTAACCTGGCCAGGTTCAAACCCTTCACTCCCCTCCATTCTTTTCAATTCCCATCTTGATT
CTGTCCCTGCTGAACCACATAAATGGACCCACCCGCCGTTTTCCGCTCACAAGACTTCCGATGGAAGAATATTTGCACGGGGAGCGCAGG
ATGATAAGTGTATTGGTATGCAGTATTTGGAAGCAATCAAAGCGATTCAAATGAGTGATTCAAAATTTGTGCCACTGAGAAATGTTCATA
TTCTGTATGTGCCTGAAGAGGAGGTTGGTGGGTTTGATGGGATGGGGAAGTTTGTGGAGTCGAAAGAATTTGGAGAGTTGAATCTTGGGT
TTGTGATGGATGAAGGACAGGCCTCGCCTAATGATGAGTTTAGGGTTTTTTATGCTGATAGGACTCCTTGGCATACGGTGATTAAGGCTG
TTGGAATGCCTGGACATGGGTCTAAATTGTATGATAATTCTGCTATGGAGAATTTGATGAAGAGTATGGAGGTTATTACTAAGTTTAGGG
AGTCTATGTTTGATATGGTCAAAGCTGGAGTGGCTGCTAATTCTGAGGTCATCTCAGTGAACCCGGTGTTTCTTAATGCTGGAACTCCTT
CCCCAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan