ESTScan Details for Unigene SGN-U582833

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
MGXLRLTIIRIGLQXFAPENGIIQNYDKLSRPGNFPSVNTLPKCCSLHPHLAGTVPGDEPCCDHRILSRSLSFSPVRCAAASKGGADDGK
KXSGGLAQVQQLLHEAKERSQAAGNDPIPKITLDHVTVNFARSGGPGGQNVNKVNTKVDMRFNVENAYWLSDRVREKILQMEKNRINKDG
ELVISSTKTRTQKGNIEDALSKLQDIIDAASYVPPPPSEEQVKRITKLAAIGERKRLDNKKAQSQKKAMQEAEIVMTDSKSSRCLTQALP
IKFSQHFDHLLHPTINDTKMFRESSVRPSSDTFLNDLTHHISXKECRHWPSKYLVLSEDVDIGPGKLRSWVSIASVVTKKRITADAHFFM
YPYRGVRG*
Predicted Coding Sequence 
ATGGGCTTXCTAAGACTCACCATTATTAGGATTGGGCTTCAAXTTTTTGCACCGGAAAATGGCATCATTCAGAACTACGACAAGCTTTCT
CGTCCGGGAAATTTTCCGTCCGTCAATACACTTCCCAAATGTTGTTCGCTTCATCCACATCTCGCCGGCACCGTACCTGGAGACGAACCT
TGTTGTGATCATCGAATTTTATCACGGAGTCTCTCTTTTAGTCCGGTTAGGTGTGCGGCGGCGTCCAAAGGTGGTGCTGATGATGGAAAG
AAGXTCTCCGGCGGGCTTGCTCAGGTTCAACAGCTGTTACATGAAGCTAAGGAGCGATCTCAAGCTGCGGGAAACGATCCTATTCCTAAG
ATTACTCTTGATCACGTGACTGTCAACTTTGCAAGAAGTGGAGGTCCTGGAGGTCAAAATGTCAATAAAGTAAATACCAAGGTGGATATG
CGGTTCAATGTTGAAAATGCTTATTGGTTAAGTGACAGAGTCAGAGAGAAGATTTTGCAAATGGAAAAGAATCGGATAAATAAGGATGGA
GAGCTTGTGATCTCTTCAACAAAGACGAGAACTCAGAAGGGTAACATCGAAGATGCTTTGAGTAAATTACAGGATATAATTGATGCTGCT
TCTTATGTACCACCACCTCCATCTGAAGAGCAAGTGAAAAGAATAACAAAATTGGCTGCTATTGGGGAGCGCAAACGACTTGACAATAAG
AAGGCCCAATCACAAAAGAAGGCTATGCAAGAAGCAGAGATAGTTATGACTGATTCCAAGAGCTCAAGATGTCTAACACAGGCACTTCCT
ATCAAGTTCTCCCAGCACTTTGATCATTTGCTTCATCCTACTATAAACGACACGAAAATGTTTAGAGAATCCTCTGTAAGGCCTTCAAGT
GACACCTTCTTGAATGACTTAACACACCATATTAGCXTAAAAGAATGTAGACATTGGCCATCAAAGTATCTTGTACTTTCTGAAGATGTT
GATATTGGACCAGGTAAACTTAGGTCTTGGGTGAGTATTGCCTCTGTAGTTACAAAGAAAAGAATAACCGCAGACGCCCATTTCTTTATG
TACCCGTATCGTGGTGTGAGAGGCTGA
Edits in Original Sequence 
AAAATGGAGGAAGATAAATAACACCAGAAAAAGAGACAAAAAGTAAAAGAGTAAAAGAAGAAGAAAGAGACGAAGAAGCAAAAGAGTAAA
AAGAAAAAAAGAACGAATCGAAGAAGCAAAAGAATGAAAAGAAGAAGAGGAAAAAGGATTGAGAAAGAGGTGAAAACCGTACAATTTTCT
TAATTCAAAAAAAAAGTTATTTTTAGTTAGAAAAAATTATGTTGATATAAATAGTAAATATTTTACAATTAGATC
(5')ATGGGCTTXCT
AAGACTCACCATTATTAGGATTGGGCTTCAAXTTTTTGCACCGGAAAATGGCATCATTCAGAACTACGACAAGCTTTCTCGTCCGGGAAA
TTTTCCGTCCGTCAATACACTTCCCAAATGTTGTTCGCTTCATCCACATCTCGCCGGCACCGTACCTGGAGACGAACCTTGTTGTGAgTC
ATCGAATTTTATCACGGAGTCTCTCTTTTAGTCCGGTTAGGTGTGCGGCGGCGTCCAAAGGTGGTGCTGATGATGGAAAGAAGXTCTCCG
GCGcGGCTTGCTCAGGTTCAACAGCTGTTACATGAAGCTAAGGAGCGATCTCAAGCTGCGGGAAACGATCCTATTCCTAAGATTACTCTT
GATCACGTGACTGTCAACTTTGCAAGAAGTGGAGGTCCTGGAGGTCAAAATGTCAATAAAGTAAATACCAAGGTGGATATGCGGTTCAAT
GTTGAAAATGCTTATTGGTTAAGTGACAGAGTCAGAGAGAAGATTTTGCAAATGGAAAAGAATCGGATAAATAAGGATGGAGAGCTTGTG
ATCTCTTCAACAAAGACGAGAACTCAGAAGGGTAACATCGAAGATGCTTTGAGTAAATTACAGGATATAATTGATGCTGCTTCTTATGTA
CCACCACCTCCATCTGAAGAGCAAGTGAAAAGAATAACAAAATTGGCTGCTATTGGGGAGCGCAAACGACTTGACAATAAGAAGGCCCAA
TCACAAAAGAAGGCTATGCgAAGAAGCAGAGATAGTTATGACTGATTCCAAGAGCTCAAGATGTCTAACACAGGCACtTTCCTATCAAGT
TCTCCCAGCACTTTGATCATTTGCTTCATCCTACtTATAAACGACACGAAAATGTTTAGAGAATCCTCTGTAAGGCCTTCAAGTGACACC
TTCTTGAtATGACTTAACACACCATATTAGCXTAAAAGAATGTAGACATTGGCCATCAAAGTATCTTGTACTTTCTGAAGATGTTGATAT
TGGACCAGGTAAACTTAGGTCTTGGGTGAGTATTGCCTCTGTAGTTACAAAGAAAAGAATAACCGCAGACGCCCATTTCTTTATGTACCC
GTATCGTGtGTGTGAGAGGCTGA(3')TTCAAGATTTTTATTGTACCGAGTTCAACCCTTTAAATTTCTTAGCACGGAATTCATTGTACT
TTTATAACTATGTGTTCATATTTAGTGATATGTAAGAAACAACAAAAATACGTAAAAGTATCGAATACCATTAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan