ESTScan Details for Unigene SGN-U583256

Score 
563
Direction 
Forward
Predicted Peptide Sequence 
MSGGGCSIVWFRRDLRVEDNPALAAGVRAGAVIAVFIYAPEEEGHYYPGRVSRWWLKQSLAHLDSSLKSLGTSLITKRSTDSISSLLEVV
KSTGATQLFFNHLYG*
Predicted Coding Sequence 
ATGTCAGGTGGTGGTTGTAGCATAGTATGGTTTAGAAGGGATCTGAGAGTGGAAGATAACCCTGCTTTGGCTGCTGGAGTTAGAGCAGGG
GCAGTTATTGCTGTGTTTATTTATGCTCCTGAAGAAGAAGGGCATTATTATCCTGGTAGAGTTTCAAGATGGTGGCTTAAGCAGAGTTTG
GCTCATCTTGATTCATCTTTGAAGAGTCTTGGAACCTCCCTTATTACAAAGAGATCTACTGATAGTATTTCTTCTCTTCTTGAAGTTGTT
AAATCTACTGGTGCTACTCAGCTCTTCTTCAATCATTTGTATGGTTAG
Edits in Original Sequence 
AAATAGAGAGAAAAAGACTAGTCTTTGGTGTTGTTGAAGGAAG(5')ATGTCAGGTGGTGGTTGTAGCATAGTATGGTTTAGAAGGGATC
TGAGAGTGGAAGATAACCCTGCTTTGGCTGCTGGAGTTAGAGCAGGGGCAGTTATTGCTGTGTTTATTTATGCTCCTGAAGAAGAAGGGC
ATTATTATCCTGGTAGAGTTTCAAGATGGTGGCTTAAGCAGAGTTTGGCTCATCTTGATTCATCTTTGAAGAGTCTTGGAACCTCCCTTA
TTACAAAGAGATCTACTGATAGTATTTCTTCTCTTCTTGAAGTTGTTAAATCTACTGGTGCTACTCAGCTCTTCTTCAATCATTTGTATG
GTTAG(3')TACTTGTTTCCATTTTTTTCTGTGGTTTTCTTGCTTCTTTAAATAAAAGATAGAGCACCACTGTTTTACTTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan