ESTScan Details for Unigene SGN-U583257

Score 
2691
Direction 
Forward
Predicted Peptide Sequence 
MSGGGCSIVWFRRDLRVEDNPALAAGVRAGAVIAVFIYAPEEEGHYYPGRVSRWWLKQSLAHLDSSLKSLGTSLITKRSTDSISSLLEVV
KSTGATQLFFNHLYDPISLVRDHRTKEILTAQGISVRSFNADLLYEPWEVNDDEGRPFTTFSAFWEKCLSMPYDPEAPLLPPKRIISGDA
SRCPSDNLVFEDESEKGSNALLARAWSPGWSNADKALTTFVNGPLLEYSQNRRKADSATTSFLSPHLHFGEVSVRKVFHFVRIKQVLWAN
EGNKAGEESVNLFLKSIGLREYSRYMSFNHPYSHERPLLGHLRYFPWVVDEGYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSS
FFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGTLPDGRELDRIDNPQFVGYKCDPHGEYVRRWLPELARLPTEWIHHPWNAPES
VLEAAGIELGSNYPLPIVEIDSAKVRLEQALSQMWQNDAAARAAIENGMEEGHGDSADSPIAFPQAMHMEMDHEPVRNNPVIVTVRRYED
QMVPSMTSSLFRAEDEENSVDIRNSVVESRAEVPTDINVAEVHRRDTRDQAVMQTARTNATPHFNFAVGRRNSEDSTAESSSSTRERDGG
VVPTWSPSSSNYSDQYVGDDNGIGTSSSYLQRHPXISPANELAAAFSNRVIIYVEFDSNKAEKQVANTDIWLSTFSTAFIYSFSHSPDLI
SHLCVYISN*
Predicted Coding Sequence 
ATGTCAGGTGGTGGTTGTAGCATAGTATGGTTTAGAAGGGATCTGAGAGTGGAAGATAACCCTGCTTTGGCTGCTGGAGTTAGAGCAGGG
GCAGTTATTGCTGTGTTTATTTATGCTCCTGAAGAAGAAGGGCATTATTATCCTGGTAGAGTTTCAAGATGGTGGCTTAAGCAGAGTTTG
GCTCATCTTGATTCATCTTTGAAGAGTCTTGGAACCTCCCTTATTACAAAGAGATCTACTGATAGTATTTCTTCTCTTCTTGAAGTTGTT
AAATCTACTGGTGCTACTCAGCTCTTCTTCAATCATTTGTATGATCCTATTTCACTTGTGAGAGATCATCGCACAAAAGAAATCTTAACA
GCTCAAGGTATATCAGTGCGTTCCTTTAATGCTGATTTGCTCTATGAACCATGGGAAGTTAATGACGATGAAGGTCGCCCGTTCACAACA
TTTTCTGCTTTTTGGGAGAAATGCCTTAGCATGCCTTATGATCCAGAAGCTCCACTTCTTCCTCCCAAAAGGATTATATCTGGTGATGCA
TCAAGATGCCCTTCAGACAACTTGGTATTTGAAGATGAATCAGAGAAAGGAAGCAATGCACTTCTTGCTCGGGCATGGTCACCTGGCTGG
AGTAATGCTGATAAAGCACTAACTACTTTCGTTAATGGACCATTACTTGAGTACTCGCAGAACCGTCGGAAAGCTGATAGTGCAACAACA
TCCTTTCTATCTCCACATTTACATTTTGGGGAAGTCAGTGTTCGTAAGGTATTCCATTTTGTTCGCATCAAGCAAGTTCTCTGGGCCAAT
GAAGGAAATAAAGCTGGTGAAGAGAGTGTTAATTTGTTCCTTAAGTCCATTGGGCTGAGGGAGTACTCAAGATACATGAGTTTTAATCAT
CCTTATAGCCATGAAAGGCCCCTTCTTGGTCACCTAAGGTACTTCCCATGGGTAGTGGATGAAGGCTACTTTAAGGCATGGAGACAAGGT
AGAACAGGTTATCCTTTGGTTGATGCTGGTATGAGAGAGTTATGGGCAACTGGTTGGCTTCATGATCGTATCCGAGTCGTGGTATCTAGT
TTCTTTGTGAAGGTTCTGCAGCTTCCATGGAGGTGGGGGATGAAGTATTTTTGGGACACATTGTTAGATGCAGATCTTGAGAGTGATGCT
CTTGGTTGGCAATATATCTCTGGTACCCTACCTGATGGTCGTGAGCTTGATCGGATTGATAATCCACAGTTTGTGGGATACAAGTGTGAC
CCTCATGGGGAATATGTCCGGCGGTGGCTTCCTGAACTTGCTAGGCTGCCCACCGAATGGATACACCATCCATGGAATGCACCAGAATCT
GTGCTTGAAGCTGCTGGCATTGAGCTGGGTTCCAATTATCCTCTTCCTATAGTTGAAATTGATTCAGCAAAAGTTAGACTAGAACAAGCC
CTATCACAAATGTGGCAGAATGATGCAGCTGCAAGAGCTGCGATTGAGAATGGTATGGAAGAAGGACATGGTGACTCTGCTGACTCCCCA
ATAGCATTTCCTCAGGCCATGCATATGGAAATGGACCATGAACCAGTCAGGAACAACCCTGTAATAGTTACTGTTCGACGCTATGAAGAT
CAAATGGTGCCAAGCATGACGTCATCTTTGTTCAGAGCTGAAGATGAAGAGAACTCCGTGGACATTAGGAATTCAGTTGTGGAAAGTAGG
GCAGAAGTTCCAACAGACATCAATGTAGCTGAAGTTCATAGGAGAGACACGCGTGACCAAGCCGTCATGCAAACTGCTCGAACCAATGCT
ACCCCACATTTTAATTTTGCGGTAGGTAGGAGGAATTCTGAAGATTCAACAGCAGAATCTTCCAGTAGTACTAGAGAAAGGGATGGGGGT
GTAGTGCCTACATGGTCTCCCTCAAGTAGTAACTATTCGGACCAATATGTTGGTGATGATAATGGTATTGGGACCAGTTCATCTTACTTG
CAAAGGCATCCAXCAATCTCACCAGCTAATGAACTGGCAGCGGCTTTCTCAAACAGGGTGATCATTTATGTGGAGTTCGATAGCAACAAG
GCGGAGAAGCAAGTGGCTAATACAGACATTTGGCTCAGCACATTTAGTACAGCATTCATCTACTCTTTCTCTCATAGTCCTGACCTGATC
AGCCATCTTTGTGTCTATATCTCTAATTGA
Edits in Original Sequence 
TTCTCATGTTACCCCACCACCATAACCAATCACCCTCAATCTCACTTTCTCCTCCCTCTTTCTCTGGAGAGGTTTGTTTTTTTGGGTGGA
CAATGCCTATAGTAACTTCACAAGAATAGCATCTCATCATTCATCAAAGAATAACATTTGGGGTTTGTTAAAGTTAGGTTCTTTACTAGA
ATTTGCCTAAAAAAAATCATCTTTGTAATCTTTATCTCCTCAGTGAAAGCTACAGGGAACAGTCAAAGTATAGATAAGATTAACCCCAAT
ATACTTCTGTCTAAGAAAGACTCAATAACATGGTGTTTACATAGTAAGAGAGAAAAATAGAGAGAAAAAGACTAGTCTTTGGTGTTGTTG
AAGGAAG
(5')ATGTCAGGTGGTGGTTGTAGCATAGTATGGTTTAGAAGGGATCTGAGAGTGGAAGATAACCCTGCTTTGGCTGCTGGAG
TTAGAGCAGGGGCAGTTATTGCTGTGTTTATTTATGCTCCTGAAGAAGAAGGGCATTATTATCCTGGTAGAGTTTCAAGATGGTGGCTTA
AGCAGAGTTTGGCTCATCTTGATTCATCTTTGAAGAGTCTTGGAACCTCCCTTATTACAAAGAGATCTACTGATAGTATTTCTTCTCTTC
TTGAAGTTGTTAAATCTACTGGTGCTACTCAGCTCTTCTTCAATCATTTGTATGATCCTATTTCACTTGTGAGAGATCATCGCACAAAAG
AAATCTTAACAGCTCAAGGTATATCAGTGCGTTCCTTTAATGCTGATTTGCTCTATGAACCATGGGAAGTTAATGACGATGAAGGTCGCC
CGTTCACAACATTTTCTGCTTTTTGGGAGAAATGCCTTAGCATGCCTTATGATCCAGAAGCTCCACTTCTTCCTCCCAAAAGGATTATAT
CTGGTGATGCATCAAGATGCCCTTCAGACAACTTGGTATTTGAAGATGAATCAGAGAAAGGAAGCAATGCACTTCTTGCTCGGGCATGGT
CACCTGGCTGGAGTAATGCTGATAAAGCACTAACTACTTTCGTTAATGGACCATTACTTGAGTACTCGCAGAACCGTCGGAAAGCTGATA
GTGCAACAACATCCTTTCTATCTCCACATTTACATTTTGGGGAAGTCAGTGTTCGTAAGGTATTCCATTTTGTTCGCATCAAGCAAGTTC
TCTGGGCCAATGAAGGAAATAAAGCTGGTGAAGAGAGTGTTAATTTGTTCCTTAAGTCCATTGGGCTGAGGGAGTACTCAAGATACATGA
GTTTTAATCATCCTTATAGCCATGAAAGGCCCCTTCTTGGTCACCTAAGGTACTTCCCATGGGTAGTGGATGAAGGCTACTTTAAGGCAT
GGAGACAAGGTAGAACAGGTTATCCTTTGGTTGATGCTGGTATGAGAGAGTTATGGGCAACTGGTTGGCTTCATGATCGTATCCGAGTCG
TGGTATCTAGTTTCTTTGTGAAGGTTCTGCAGCTTCCATGGAGGTGGGGGATGAAGTATTTTTGGGACACATTGTTAGATGCAGATCTTG
AGAGTGATGCTCTTGGTTGGCAATATATCTCTGGTACCCTACCTGATGGTCGTGAGCTTGATCGGATTGATAATCCACAGTTTGTGGGAT
ACAAGTGTGACCCTCATGGGGAATATGTCCGGCGGTGGCTTCCTGAACTTGCTAGGCTGCCCACCGAATGGATACACCATCCATGGAATG
CACCAGAATCTGTGCTTGAAGCTGCTGGCATTGAGCTGGGTTCCAATTATCCTCTTCCTATAGTTGAAATTGATTCAGCAAAAGTTAGAC
TAGAACAAGCCCTATCACAAATGTGGCAGAATGATGCAGCTGCAAGAGCTGCGATTGAGAATGGTATGGAAGAAGGACATGGTGACTCTG
CTGACTCCCCAATAGCATTTCCTCAGGCCATGCATATGGAAATGGACCATGAACCAGTCAGGAACAACCCTGTAATAGTTACTGTTCGAC
GCTATGAAGATCAAATGGTGCCAAGCATGACGTCATCTTTGTTCAGAGCTGAAGATGAAGAGAACTCCGTGGACATTAGGAATTCAGTTG
TGGAAAGTAGGGCAGAAGTTCCAACAGACATCAATGTAGCTGAAGTTCATAGGAGAGACACGCGTGACCAAGCCGTCATGCAAACTGCTC
GAACCAATGCTACCCCACATTTTAATTTTGCGGTAGGTAGGAGGAATTCTGAAGATTCAACAGCAGAATCTTCCAGTAGTACTAGAGAAA
GGGATGGGGGTGTAGTGCCTACATGGTCTCCCTCAAGTAGTAACTATTCGGACCAATATGTTGGTGATGATAATGGTATTGGGACCAGTT
CATCTTACTTGCAAAGGCATCCAXCAATCTCACCAGCTAATGAACTGGCAGCGGCTTTCTCAAACAGGGTGATCATTTATGTGGAGTTaC
GATAGCAACAAGGCGGAGAAGCAAGTGGCTAATACAGACATTTGGCTCAGCACATTTAGTACAGCATTCATCTACTCTTTCTCTCATAGT
CCTGACCTGATCAGCCATCTTTGTGTCTATATCTCTAATTGA(3')TCAGGTGGTTCGTCTGGATTTTCATCCTCATCTGTCGGGCATCC
CCATTTACCTATTATACCATATATGTGTCTCTGCTGTATAGTATAGAAGTTTTTCATAAGGCCAAATAAGTGTTAGAAAGAGGTTGCAGT
CCTCTGTCAAGCTCACACTTGTGCCTTTTGTTTTTCCTTCTCTTTTCTGCTACTTACATTTTGATGGCAATAACGATTATCTGAAGTCCT
GGAACTAATTAGATTTTTGTGGATATCATAGTTTCAAACTCTGTTTGACGGATGTACATGTGGTTTAAGCAGCTTCATCTCATATTTTTG
TT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan