ESTScan Details for Unigene SGN-U583361

Score 
880
Direction 
Forward
Predicted Peptide Sequence 
MVVEVCVKAAVGAPDVLGDCPFSQRVLLTLEEKKVTYKKHLINVSDKPKWFLEVNPEGKVPVINFGDKWIPDSDVIVGIIEEKYPNPSLI
APPEFASVGSKIFPTFVSFLKSKDSSDSTEQALLDELKALEEHLKAHGPYINGQNVCSVDMSLAPKLYHLEVALGHFKKWSVPESLSHVR
NYMKLLFERESFQKTKAEEKYVIAGWAPKV*
Predicted Coding Sequence 
ATGGTTGTTGAAGTTTGTGTCAAGGCTGCTGTGGGTGCCCCTGATGTCCTTGGAGACTGTCCATTTAGCCAAAGGGTACTTCTGACATTG
GAGGAAAAGAAAGTGACTTACAAGAAGCACTTGATCAATGTTAGTGACAAGCCCAAATGGTTCTTGGAGGTGAACCCTGAAGGGAAAGTT
CCCGTGATCAATTTTGGTGACAAATGGATCCCAGATTCTGATGTCATTGTTGGGATTATTGAAGAGAAATACCCAAATCCCTCTCTCATT
GCTCCCCCTGAATTTGCCTCTGTGGGCTCGAAAATATTTCCTACCTTCGTCTCATTTCTGAAGAGCAAGGATTCTAGTGACAGTACTGAG
CAGGCTCTCCTTGATGAACTAAAGGCTTTGGAAGAGCATCTCAAGGCTCATGGACCATATATCAATGGGCAGAATGTTTGTTCAGTTGAT
ATGAGCTTGGCTCCAAAACTGTACCATCTCGAGGTGGCTCTTGGACACTTCAAGAAGTGGAGTGTGCCTGAAAGCTTGAGTCATGTGCGT
AACTACATGAAGCTGCTCTTCGAGCGAGAGTCGTTCCAGAAAACCAAGGCTGAAGAGAAGTACGTCATCGCAGGGTGGGCTCCAAAGGTT
TAA
Edits in Original Sequence 
GTTGTTTTTATTGTTTTTCAAATTCTTTGAAAATTTGAAAATTACCTATTTTGTAAGCATTAGAGAATTGGACATGTGGAAAATGCTTTT
TAGATAGGACACTATATTATTGTACACTTCTCACACAAAGAACACACTCAATTTGTGAGTTATCTTCTTCAGAATTCTCTCTGTTCATCA
ATC
(5')ATGGTTGTTGAAGTTTGTGTCAAGGCTGCTGTGGGTGCCCCTGATGTCCTTGGAGACTGTCCATTTAGCCAAAGGGTACTTCT
GACATTGGAGGAAAAGAAAGTGACTTACAAGAAGCACTTGATCAATGTTAGTGACAAGCCCAAATGGTTCTTGGAGGTGAACCCTGAAGG
GAAAGTTCCCGTGATCAATTTTGGTGACAAATGGATCCCAGATTCTGATGTCATTGTTGGGATTATTGAAGAGAAATACCCAAATCCCTC
TCTCATTGCTCCCCCTGAATTTGCCTCTGTGGGCTCGAAAATATTTCCTACCTTCGTCTCATTTCTGAAGAGCAAGGATTCTAGTGACAG
TACTGAGCAGGCTCTCCTTGATGAACTAAAGGCTTTGGAAGAGCATCTCAAGGCTCATGGACCATATATCAATGGGCAGAATGTTTGTTC
AGTTGATATGAGCTTGGCTCCAAAACTGTACCATCTCGAGGTGGCTCTTGGACACTTCAAGAAGTGGAGTGTGCCTGAAAGCTTGAGTCA
TGTGCGTAACTACATGAAGCTGCTCTTCGAGCGAGAGTCGTTCCAGAAAACCAAGGCTGAAGAGAAGTACGTCATCGCAGGGTGGGCTCC
AAAGGTTTAA(3')CGTATGACTGACTCGAAACTATAATCATGTTTTGTCTCGAGTAGTTAGCAGTTCGACGAGTGCAGCTTTATGAACG
TGATCTATATAGTATGATCTAAATAAAAACGTTCATCGTTGGTCTGTGTATCGATTAATCCTTGTACTGTTTGTGTCTAATAAACTAAGT
TATCTTCTGAAACTTTTATTAGTTAATGTAAGGTGTGTTATAAAATCAAGCCCATAAGAATATAATCATAAAGAGAAGTAGATAGAAGAA
TGAGAATTTTCTTCTTATTCAAGTGTATATAACTTTCATATGTCTATATTACAATAGTGAATGAACAACCCTATTTATAGAGTGAGAAAT
CACTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan