ESTScan Details for Unigene SGN-U583385

Score 
1519
Direction 
Forward
Predicted Peptide Sequence 
KSCGCTLTNXVSVFHSIQSHHSLLNPTTSAXPTKPRDLVGEPAGFVTSINEFAMSSSSSFMVASSCCQNLQTRKYFLLAPEPFEKIGMID
ALQKYNRKERKVFISSHLVPGHLDASGTRKKFLHEPVPKLEFVRTLLIDNYDSYTYNIFQELSIINGMPPVVIRNDEWTWKEVYHYLYEE
RTFDNIVISPGPGSPTCPSDIGICLRLLLECIDIPILGVCLGHQALGYVHGAEVVHAPEPFHGRLSDIEHNGCQLFHEIPSGRSSGFKVV
RYHSLVIDPKSLPKELIPIAWTSTAETLPFQGVKRSNSFLNASKENKDIFNGMSELSDDSKDVKGGKVLMGIMHSSRPHYGLQFHPESVA
TCYGRQLFKNFRKITEDYWLLLMSTSFNERRAHYAACMQVPNLDXAVPSVAKRGHLVNKLIERRTAEVDGTLNLSHPGHSVKFLKMTWKK
LDCSASQVGGADNIFCELFGDQEAKNSFWLDSSSIEKERARFSFMGGKGGSLWKQLSFRLSNRSDRMCKGGGHLSVEDANGHVISKFLED
GFFDYLDKELLSFCFDEKDYEGLPFDFYGGYIGYIGYDLKAECGVASNRHRSKTPDACLFFTDNVIVIDHQYDDXIYFVITRWQHKYYFS
LGRSGAEAAQLESFYAQKATIEASRGFSVVELKSGFSAEKSREQYIKDVENCQEFIKEGESYELCLTTQMRMKLGGIDSLELYRNLRIRN
PAPYAAWLNFSRENLSICCSSPERFLRLDRNAILEAKPIKGTIARGSTPKEDEFLKLQLECSEKDQAENLMIVDLLRNDLGRVCETGSVH
VPHLMEIESYATVHTMVSTIRGKKRSDASAIDCVRAAFPGGSMTGAPKLRSMELLDHLENVRGAYTRAALDFFLXNQAFDLNIVIRTVVI
HEGEASVGAGGAITALSDPNDEYEEMLLKTRAPIKAVLEHQSSIFSSDAQKDMPVEMSNAEIVVLNSLRFWENVGAIAASSSYN*
Predicted Coding Sequence 
AAATCTTGTGGTTGCACACTCACCAATGXTGTGTCTGTTTTCCACTCCATTCAATCTCATCATTCTTTGCTCAACCCCACCACTTCCGCC
AAXCCCACCAAACCGAGGGATTTGGTTGGTGAACCTGCXGGTTTCGTTACAAGCATAAATGAATTTGCCATGTCTTCGTCATCATCATTT
ATGGTTGCCTCTTCCTGCTGCCAAAATCTTCAAACCAGAAAATATTTTCTTTTAGCACCTGAACCTTTTGAGAAGATTGGTATGATAGAT
GCACTCCAAAAATATAACCGTAAGGAAAGGAAGGTATTTATTTCAAGTCATTTAGTGCCTGGACATTTGGATGCATCGGGAACAAGAAAA
AAGTTTTTACATGAGCCAGTTCCGAAGTTAGAATTTGTACGCACACTACTAATTGACAACTATGACAGTTACACTTACAATATTTTCCAA
GAGCTCTCAATCATTAATGGAATGCCTCCGGTGGTGATTCGGAATGATGAGTGGACATGGAAAGAAGTTTATCATTACCTGTACGAAGAA
AGGACGTTTGACAATATTGTTATATCACCTGGTCCTGGCTCTCCAACATGTCCATCAGATATAGGAATTTGCCTGAGGCTCTTGCTTGAA
TGCATTGATATCCCGATACTAGGCGTCTGCCTTGGTCACCAGGCATTGGGATATGTGCATGGTGCTGAAGTTGTACATGCACCTGAACCT
TTCCATGGTCGTTTGAGTGATATTGAGCACAATGGTTGTCAATTATTCCATGAAATTCCTTCAGGAAGAAGTTCTGGATTTAAGGTGGTA
CGGTACCATTCCCTTGTAATAGACCCGAAATCACTTCCGAAGGAACTCATTCCTATAGCTTGGACCTCAACAGCTGAGACACTCCCTTTC
CAGGGTGTCAAACGATCCAATTCATTCTTAAATGCGTCCAAAGAAAATAAAGATATTTTTAATGGGATGTCGGAGCTATCAGATGATTCA
AAGGATGTGAAAGGTGGAAAAGTCCTCATGGGTATCATGCATTCTAGTAGGCCTCACTATGGATTGCAGTTCCACCCAGAAAGTGTTGCA
ACATGTTACGGAAGACAGCTTTTCAAGAATTTCCGGAAAATCACAGAGGATTATTGGCTCCTGCTGATGTCAACCTCCTTCAATGAAAGA
AGGGCTCATTATGCTGCATGCATGCAGGTGCCTAATTTAGACXCCGCTGTCCCAAGTGTTGCAAAACGTGGGCATCTGGTGAATAAATTG
ATTGAGAGGAGAACTGCCGAAGTGGATGGAACCTTAAATCTATCACATCCAGGTCACAGTGTAAAATTTTTGAAGATGACATGGAAAAAA
CTTGATTGCTCTGCGAGCCAAGTAGGTGGAGCGGATAATATTTTCTGTGAACTATTTGGAGATCAAGAGGCTAAAAACAGTTTTTGGCTG
GATAGCTCTTCAATAGAGAAGGAAAGGGCTAGATTTTCCTTTATGGGGGGAAAGGGTGGCTCCCTCTGGAAGCAACTTAGTTTTAGGTTG
TCAAATCGAAGTGACAGAATGTGTAAAGGAGGTGGCCATCTATCAGTTGAAGATGCTAATGGTCATGTTATTTCTAAATTTTTGGAAGAT
GGATTTTTTGATTATTTAGATAAGGAGCTCCTATCATTTTGTTTCGATGAGAAGGATTATGAAGGATTACCATTTGATTTTTATGGTGGT
TACATTGGTTATATCGGGTATGATCTTAAAGCTGAATGTGGTGTGGCATCTAATCGTCATAGATCCAAAACACCAGATGCTTGTTTATTC
TTTACAGATAACGTTATTGTCATTGATCATCAGTATGATGACATXATATACTTTGTCATTACACGATGGCAGCACAAGTACTACTTCTCG
CTTGGAAGATCTGGAGCAGAGGCTGCTCAACTTGAGAGCTTTTACGCCCAGAAGGCTACAATCGAGGCATCTCGAGGATTTTCTGTAGTC
GAACTAAAATCAGGGTTTTCTGCTGAGAAATCAAGAGAGCAGTATATCAAAGACGTTGAGAATTGTCAAGAGTTCATAAAAGAAGGAGAA
AGTTATGAGTTGTGTCTTACAACTCAGATGAGAATGAAGTTGGGGGGAATAGATTCTCTGGAACTTTATCGTAATCTCAGAATAAGAAAT
CCTGCACCATATGCTGCCTGGCTTAATTTTTCAAGGGAAAACCTAAGCATATGTTGTTCATCACCTGAAAGGTTCCTACGATTGGACAGG
AATGCTATTCTAGAAGCAAAACCCATAAAAGGGACTATAGCTCGTGGTTCCACCCCAAAGGAAGATGAATTTCTGAAACTGCAATTAGAA
TGCAGTGAAAAGGATCAGGCGGAAAATTTGATGATTGTTGACTTGTTGAGGAATGACCTTGGGCGTGTATGTGAGACTGGCTCTGTTCAT
GTCCCACATCTCATGGAAATTGAATCCTATGCAACAGTTCATACCATGGTCAGTACGATTCGGGGGAAAAAGCGATCAGATGCAAGTGCA
ATTGATTGTGTTAGAGCTGCATTCCCTGGTGGGTCAATGACAGGTGCACCAAAGTTGAGATCAATGGAACTTCTTGATCATCTTGAAAAT
GTTCGAGGGGCATATACTCGGGCTGCATTGGATTTTTTTCTTXATAACCAAGCATTTGATCTCAATATTGTGATACGGACGGTTGTCATA
CACGAGGGAGAAGCTTCAGTAGGAGCAGGAGGAGCCATCACTGCTCTTTCAGATCCTAATGATGAGTATGAAGAAATGCTTCTTAAAACT
CGAGCACCGATTAAGGCTGTTCTTGAACATCAGAGCAGCATCTTCTCATCAGATGCTCAGAAGGACATGCCAGTTGAAATGTCCAATGCA
GAAATAGTGGTATTGAACTCTCTTAGATTCTGGGAAAATGTGGGAGCAATTGCAGCTTCTAGTAGTTATAATTAA
Edits in Original Sequence 
(5')AAATCTTGTGGTTGCACACTCACCAATGXTGTGTCTGTTTTCCACTCCATTCAATCTCATCATTCTTTGCTCAACCCCACCACTTC
CGCCAAXCCCACCAAACCGAGGGATTTGGTTGGTGAACCTGCXGGTTTCGTTACAAGCATAAATGAATTcTGCCATGTCTTCGTCATCAT
CATTTATGGTTGCCTCTTCCTGCTGCCAAAATCTTCAAACCAGAAAATATTTTCTTTTAGCACCTGAACCTTTTGAGAAGATTGGTATGA
TAGATGCACTCCAAAAATATAACCGTAAGGAAAGGAAGGTATTTATTTCAAGTCATTTAGTGCCTGGACATTTGGATGCATCGGGAACAA
GAAAAAAGTTTTTACATGAGCCAGTTCCGAAGTTAGAATTTGTACGCACACTACTAATTGACAACTATGACAGTTACACTTACAATATTT
TCCAAGAGCTCTCAATCATTAATGGAATGCCTCCGGTGGTGATTCGGAATGATGAGTGGACATGGAAAGAAGTTTATCATTACCTGTACG
AAGAAAGGACGTTTGACAATATTGTTATATCACCTGGTCCTGGCTCTCCAACATGTCCATCAGATATAGGAATTTGCCTGAGGCTCTTGC
TTGAATGCATTGATATCCCGATACTAGGCGTCTGCCTTGGTCACCAGGCATTGGGATATGTGCATGGTGCTGAAGTTGTACATGCACCTG
AACCTTTCCATGGTCGTTTGAGTGATATTGAGCACAATGGTTGTCAATTATTCCATGAAATTCCTTCAGGAAGAAGTTCTGGATTTAAGG
TGGTACGGTACCATTCCCTTGTAATAGACCCGAAATCACTTCCGAAGGAACTCATTCCTATAGCTTGGACCTCAACAGCTGAGACACTCC
CTTTCCAGGGTGTCAAACGATCCAATTCATTCTTAAATGCGTCCAAAGAAAATAAAGATATTTTTAATGGGATGTCGGAGCTATCAGATG
ATTCAAAGGATGTGAAAGGTGGAAAAGTCCTCATGGGTATCATGCATTCTAGTAGGCCTCACTATGGATTGCAGTTCCACCCAGAAAGTG
TTGCAACATGTTACGGAAGACAGCTTTTCAAGAATTTCCGGAAAATCACAGAGGATTATTGGCTCCTGCTGATGTCAACCTCCTTCAATG
AAAGAAGGGCTCATTATGCTGCATGCATGCAGGTGCCTAATTTAGACXCCGCTGTCCCgAAGTGTTGCAAAACGTGGGCATCTGGTGAAT
AAATTGATTGAGAGGAGAACTGCCGAAGTGGATGGAACCTTAAATCTATCACATCCAGGTCACAGTGTAAAATTTTTGAAGATGACATGG
AAAAAACTTGATTGCTCTGCGAGCCAAGTAGGTGGAGCGGATAATATTTTCTGTGAACTATTTGGAGATCAAGAGGCTAAAAACAGTTTT
TGGCTGGATAGCTCTTCAATAGAGAAGGAAAGGGCTAGATTTTCCTTTATGGGGGGAAAGGGTGGCTCCCTCTGGAAGCAACTTAGTTTT
AGGTTGTCAAATCGAAGTGACAGAATGTGTAAAGGAGGTGGCCATCTATCAGTTGAAGATGCTAATGGTCATGTTATTTCTAAATTTTTG
GAAGATGGATTTTTTGATTATTTAGATAAGGAGCTCCTATCATTTTGTTTCGATGAGAAGGATTATGAAGGATTACCATTTGATTTTTAT
GGTGGTTACATTGGTTATATCGGGTATGATCTTAAAGCTGAATGTGGTGTGGCATCTAATCGTCATAGATCCAAAACACCAGATGCTTGT
TTATTCTTTACAGATAACGTTATTGTCATTGATCATCAGTATGATGACATXATATACTTTGTCATTACACGATGGCAGCACAAGTACTAC
TTCTCGCTTGGAAGATCTGGAGCAGAGGCTGCTCAACTTGAGAGCTTTTACGCCCAGAAGGCTACAATCGcAGGCATCTCGAGGATTTTC
TGTAGTCGAACTAAAATCAGGGTTTTCTGCTGAGAAATCAAGAGAGCAGTATATCAAAGACGTTGAGAATTGTCAAGAGTTCATAAAAGA
AGGAGAAAGTTATGAGTTGTGTCTTACAACTCAGATGAGAATGAAGTTGGGGGGAATAGATTCTCTGGAACTTTATCGTAATCTCAGAAT
AAGAAATCCTGCACCATATGCTGCCTGGCTTAATTTTTCAAGGGAAAACCTAAGCATATGTTGTTCATCACCTGAAAGGTTCCTACGATT
GGACAGGAATGCTATTCTAGAAGCAAAACCCATAAAAGGGACTATAGCTCGTGGTTCCACCCCAAAGGAAGATGAATTTCTGAAACTGCA
ATTAGAATGCAGTGAAAAGGATCAGGCGGAAAATTTGATGATTGTTGACTTGTTGAGGAATGACCTTGGGCGTGTATGTGAGACTGGCTC
TGTTCATGTCCCACATCTCATGGAAATTGAATCCTATGCAACAGTTCATACCATGGTCAGTACGATTCGGGGGAAAAAGCGATCAGATGC
AAGTGCAATTGATTGTGTTAGAGCTGCATTCCCTGGTGGGTCAATGACAGGTGCACCAAAGTTGAGATCAATGGAACTTCTTGATCATCT
TGAAAAtTGTTCGAGGGGCATATACTCGGGCTGCATTGGATTTTTTTCTTXATAACCAAGCATTTGATCTCAATATTGTGATACGGACGG
TTGTCATACACGAGGGAGAAGCTTCAGTAGGAGCAGGAGGAGCCATCACTGCTCTTTCAGATCCTAATGATGAGTATGAAGAAATGCTTC
TTAAAACTCGAGCACCGATTAAGGCTGTTCTTGAACATCAGAGCAGCATCTTCTCATCAGATGCTCAGAAGtGACATGaCCAGTTGAAAT
GTCCAATGCAGAAATAGTGGTATTGAACTCTCTTAGATTCTGGGAAAATGTGGGAGCAATTGCAGCTTCTAGTAGTTATAATTAA(3')A
AGGGAGGGGAAACAGTGGATGAAAGCCTATATAATTCATGCAAATATTTGTCATGACCTTGTTTTGTCAGCACAATCTATTCATTCTTTT
GAGCATAGTGTTTGGAAAATATAGCCATGGTAGCATACAGATCTGCAGTGACTAAAATACTGTACATAGAAGATTTTGAAAGACCTGTAG
AAGATTACAGATATGTTTGTGAAGTTGTACTAGTACTGAATTGATGATTCCACGTTTCATTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan