ESTScan Details for Unigene SGN-U583622

Score 
791
Direction 
Forward
Predicted Peptide Sequence 
MDSGSSAYLSMVDPFLVEALQNPRHRLTILRMELDIQKFLQSSDVQQFEFPHFPTSYLRLAAHRVAQHYGLQTMVQDNVVDGQGAKILVT
RKPESKYPAVRLSDVPPKQSDSDKYEKMKIVIQPRPSNTSSKDSELGAKRSQVRTVEERKEEYDRARARIFNSPINSETRDNLVHVASDL
KNNIDENESSNRLLLDMEKSISNREGGTSSRVAIFRDREKELSDPDYDRNYVRYVKSVPSGQCFSVAPFDVQKFQPPYVHYDAVFPQMSQ
LPSAQASPNYRSPVLSPYHAMGFNQTLNDGVFMQWPTQSMIYAHSYDQVRHALLSAFFLSATAKLW
Predicted Coding Sequence 
ATGGATTCGGGTTCTTCTGCTTATTTGTCAATGGTGGATCCTTTCTTGGTTGAAGCCCTTCAAAACCCACGTCATCGTCTTACCATTCTA
AGAATGGAACTCGACATTCAGAAGTTCTTGCAAAGTTCCGACGTGCAACAGTTTGAGTTCCCACATTTTCCGACTTCCTACCTTCGTCTT
GCTGCGCACCGTGTTGCTCAACACTATGGTTTGCAGACTATGGTTCAGGATAATGTTGTGGATGGTCAGGGAGCCAAAATCCTGGTGACA
AGAAAACCTGAAAGCAAATACCCTGCTGTGCGTTTATCGGACGTCCCACCTAAACAATCTGACAGTGACAAATACGAGAAGATGAAAATA
GTAATACAACCAAGGCCGAGTAACACCTCTTCGAAAGATAGTGAATTGGGTGCAAAACGCAGTCAAGTAAGAACTGTGGAAGAGAGAAAA
GAGGAGTATGACAGGGCACGTGCACGCATTTTTAATAGTCCTATTAACTCTGAGACTAGAGACAATTTGGTTCATGTTGCTTCTGACCTC
AAGAACAACATAGATGAGAATGAATCTTCAAACAGGTTACTCTTGGATATGGAGAAAAGCATCAGCAACAGAGAAGGTGGTACTTCTTCC
CGAGTTGCCATCTTTAGGGACAGGGAGAAAGAGCTGAGTGACCCTGATTATGACCGGAATTATGTTAGATATGTTAAGAGCGTCCCATCT
GGTCAGTGCTTTAGCGTGGCACCTTTTGATGTGCAGAAGTTTCAGCCTCCATATGTACATTACGATGCTGTTTTTCCTCAGATGAGTCAG
CTGCCCAGTGCTCAAGCTTCACCAAATTACAGGAGCCCTGTTCTTAGCCCATACCATGCCATGGGATTCAATCAGACCCTCAATGATGGA
GTATTCATGCAGTGGCCAACCCAGAGCATGATTTATGCACATTCATATGATCAAGTTAGACATGCXCTTCTTTCAGCCTTCTTTCTGTCA
GCAACCGCTAAGCTTTGG
Edits in Original Sequence 
GGGGAATGAGACCCTTTTCTTCTTCTTCTTCTTGTTGGGGGATAAGAAGCCAATAAGGGTTTTCTCTTCTCAATTTCTCTCTTCTTTTTC
TTCTCTACAGAGAAAGAGAGAGTTGTTCAAAGAAAATCTCTTCTTCTTCTTCTTCATATCCCTTTTGGGGTTGAAGAAAAAAGAAGGAAA
GAAACAGAGAGAGAGCGACAAAAAACCCTTTTGTATTCCAATTTTTGGATACATATATTACCCATCCTTCTATACATATCTTTTTAAGGG
AGTTTTTTTTTTACTTTTTAACA
(5')ATGGATTCGGGTTCTTCTGCTTATTTGTCAATGGTGGATCCTTTCTTGGTTGAAGCCCTTCAA
AACCCACGTCATCGTCTTACCATTCTAAGAATGGAACTCGACATTCAGAAGTTCTTGCAAAGTTCCGACGTGCAACAGTTTGAGTTCCCA
CATTTTCCGACTTCCTACCTTCGTCTTGCTGCGCACCGTGTTGCTCAACACTATGGTTTGCAGACTATGGTTCAGGATAATGTTGTGGAT
GGTCAGGGAGCCAAAATCCTGGTGACAAGAAAACCTGAAAGCAAATACCCTGCTGTGCGTTTATCGGACGTCCCACCTAAACAATCTGAC
AGTGACAAATACGAGAAGATGAAAATAGTAATACAACCAAGGCCGAGTAACACCTCTTCGAAAGATAGTGAATTGGGTGCAAAACGCAGT
CAAGTAAGAACTGTGGAAGAGAGAAAAGAGGAGTATGACAGGGCACGTGCACGCATTTTTAATAGTCCTATTAACTCTGAGACTAGAGAC
AATTTGGTTCATGTTGCTTCTGACCTCAAGAACAACATAGATGAGAATGAATCTTCAAACAGGTTACTCTTGGATATGGAGAAAAGCATC
AGCAACAGAGAAGGTGGTACTTCTTCCCGAGTTGCCATCTTTAGGGACAGGGAGAAAGAGCTGAGTGACCCTGATTATGACCGGAATTAT
GTTAGATATGTTAAGAGCGTCCCATCTGGTCAGTGCTTTAGCGTGGCACCTTTTGATGTGCAGAAGTTTCAGCCTCCATATGTACATTAC
GATGCTGTTTTTCCTCAGATGAGTCAGCTGCCCAGTGCTCAAGCTTCACCAAATTACAGGAGCCCTGTTCTTAGCCCATACCATGCCATG
GGATTCAATCAGACCCTCAATGATGGAGTATTCATGCAGTGGCCAACCCAGAGCATGATTTATGCACATTCATATGATCAAGTTAGACAT
GCXCTTCTTTCAGCCTTCTTTCTGTCAGCAACCGCTAAGCTTTGG(3')ATACTCCCAGAACCACAGTTGATGAATGTAATTTTTGTTCT
CTCTTAGTGCTCTATCCTGGTGTAGGTTAAAAATGTAATACTCTATTAAACTTGGTGCTCTGCATTATTAGTCCCTTTTGCTTTTCATTT
TTTGGAACTCAGTTCGAGTGGAAGAATTAAGTACTGACTTCATATGAACTACTATATGCATTTGCTATTATTACTCCCTTACTATTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan