ESTScan Details for Unigene SGN-U583623

Score 
600
Direction 
Forward
Predicted Peptide Sequence 
XQTLNDGVFMQWPTQSMIYAHSYDQVRHAFFQPSFWEYPKLSXLPLSLAHRQPVKMFKKFSTEEVSGQNQVKASVQRRIRQSIAEEYPLL
EPVLEDLLPKKSPLIVAKCQNHLNLVVVNNVPLFFNIRDGPYMPTLRLLHQYPNIMKKLQVDRGAIKFVLSGANIMCPGLTSPGGALDVE
VGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKMERLD*
Predicted Coding Sequence 
XXTCAGACCCTCAATGATGGAGTATTCATGCAGTGGCCAACCCAGAGCATGATTTATGCACATTCATATGATCAAGTTAGACATGCCTTC
TTTCAGCCTTCTTTCTGGGAGTATCCAAAGCTTAGCXGGTTGCCTCTCTCTCTCGCTCATCGTCAGCCCGTGAAAATGTTCAAGAAGTTT
TCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAAGCATTGCAGAAGAGTACCCACTACTA
GAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATCATCTGAATTTAGTTGTGGTAAACAAT
GTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAATATCCAAATATAATGAAAAAACTACAA
GTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTTCTCCTGGGGGTGCTTTGGATGTTGAA
GTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCTTTACAAAGATGTCGGCAAAGGATATA
AAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGATGGAGCGTCTGGATTGA
Edits in Original Sequence 
(5')XXTCAGACCCTCAATGATGGAGTATTCATGCAGTGGCCAACCCAGAGCATGATTTATGCACATTCATATGATCAAGTTAGACATGC
CTTCTTTCAGCCTTCTTTCTGGGAGTATCCAAAGCTTAGCXGGTTGCCTCTCTCTCTCGCTCATCGTCAGCCCGTGAAAATGTTCAAGAA
GTTTTCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAAGCATTGCAGAAGAGTACCCACT
ACTAGAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATCATCTGAATTTAGTTGTGGTAAA
CAATGTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAATATCCAAATATAATGAAAAAACT
ACAAGTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTTCTCCTGGGGGTGCTTTGGATGT
TGAAGTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCTTTACAAAGATGTCGGCAAAGGA
TATAAAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGATGGAGCGTCTGGATTGA(3')G
CTTTAAATGGTATCTTTACTAGATGGACAATGTTTACCTGCTGCAAATAGCAAAGACTTGCTCATTTTTATGCAGCTGTTATTTCGTTTC
TCCAGATGTTAATGAGCAAGCTGAACCAAAGTTTCTTAATTTAATGAAGGGGAGCCAAGTTTTAGGGGATTTATACAATTTATGATTATT
GTTTTGGAACTACAAATTTTCTTAATCCGCTCGATCAAAGGAACATGAGTGGTGTTTGTGTCTGAATCTTAACTTTGGACAATCAAGATA
ATCAAAAGTTAAATATACAAAAAAAGGCCAATGAAATTTAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan