ESTScan Details for Unigene SGN-U583661

Score 
551
Direction 
Forward
Predicted Peptide Sequence 
MGSCFSIEEDESEPRPHNKPVGHGVGAYPRSNPVIPQNANLNAHDPEKANSIVVIPKNVKDLRQNPGSSDLDIFTYEEMKLSTKHFRPDK
VLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREXAGRGELLGAYSTSESGEADRVCCEDYHRLLVYEYMASGSLEKHLFP
KVCATLSWSRRMRIALDAAKGLAFLHGAERPIIYRDFXDVKHFVECRI
Predicted Coding Sequence 
ATGGGTTCTTGTTTTAGTATTGAAGAAGATGAATCAGAACCGCGACCACATAACAAGCCAGTTGGCCATGGAGTTGGTGCATATCCCAGA
TCAAATCCTGTAATTCCCCAGAATGCAAATCTTAATGCTCATGACCCCGAAAAGGCAAACAGCATTGTGGTGATTCCCAAAAATGTCAAG
GACCTGCGGCAGAATCCTGGGAGTAGCGACCTTGATATCTTCACATATGAAGAGATGAAGTTGTCTACCAAGCACTTCCGACCAGATAAG
GTACTCGGAGAGGGTGGGTTTGGCATTGTCTACAAAGGAGTTATTGATGAAAATGTCAGACCAGGATACAAGACCACATATGTTGCCATT
AAGGAGCTTGATCCAGAAAGTCTTCAGGGCGACAGAGAGXTGGCTGGCAGAGGTGAATTACTTGGGGCATATTCGACATCCGAATCTGGT
GAAGCTGATAGGGTTTGCTGTGAGGATTACCATAGACTGTTGGTTTATGAATATATGGCATCTGGCAGCCTGGAAAAGCACCTTTTCCCT
AAAGTGTGTGCTACTCTATCTTGGTCAAGAAGAATGAGAATTGCTTTGGATGCTGCTAAAGGGCTTGCTTTTCTTCATGGGGCTGAAAGG
CCTATAATATATAGGGACTTCXACGACGTGAAACATTTTGTTGAATGCCGAATT
Edits in Original Sequence 
GGAATTATCTTCCTACCAAAACACTTGACTGAATGAATAATCAGATCAAACACTCTCTTAAAAAACCCGAAAAAATTAAAATGAATTTAG
TGGTTCCACTTGTTTAGACCCTTCCTTCTTCTTCTTCTTCTTCTTCTTCTCTGCATTACATACAAGATTTTTCTCTGTTCCCCTCACATT
TCTTGGAGTATCCCCACTGACCCAGATCGGATTCTTGCAATATTTATCAAGTTTCCTGTTACCCATTTCAGATTCTGTTGGCAATTGAGA
GTGACAACTTAGTAAACTGTTTTAAGGAAAAAGAAAGGATTTTTAGTGCATAAAGATCTTATCTTTAAGTTTCTTTTGGGTAACTGAAAT
GCAAATCTGTTGTTAAGGACAGATTTC
(5')ATGGGTTCTTGTTTTAGTATTGAAGAAGATGAATCAGAACCGCGACCACATAACAAGCC
AGTTGGCCATGGAGTTGGTGCATATCCCAGATCAAATCCTGTAATTCCCCAGAATGCAAATCTTAATGCTCATGACCCCGAAAAGGCAAA
CAGCATTGTGGTGATTCCCAAAAATGTCAAGGACCTGCGGCAGAATCCTGGGAGTAGCGACCTTGATATCTTCACATATGAAGAGATGAA
GTTGTCTACCAAGCACTTCCGACCAGATAAGGTACTCGGAGAGGGTGGGTTTGGCATTGTCTACAAAGGAGTTATTGATGAAAATGTCAG
ACCAGGATACAAGACCACATATGTTGCCATTAAGGAGCTTGATCCAGAAAGTCTTCAGGGCGACAGAGAGXTGGCTGGCAGAGGTGAATT
ACTTGGGGCATATTCGACATCCGAATCTGGTGAAGCTGATAGGGTaTTGCTGTGAGGATTACCATAGACTGTTGGTTTATGAATATATGG
CATCTGGCAGCCTGGAAAAGCACCTTTTCCCTAAAGTGTGTGCTACTCTATCTTGGTCAAGAAGAATGAGAATTGCTTTGGATGCTGCTA
AAGGGCTTGCTTTTCTTCATGGGGCTGAAAGGCCTATAATATATAGGGACTTCXACGACGTGAAACATTTTGTTGAATGCCGAATT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan