ESTScan Details for Unigene SGN-U583670

Score 
1351
Direction 
Forward
Predicted Peptide Sequence 
MATEPKKIIIDTDPGIDDAMAIFVALESPEVEVIGLTTIYGNVYTTLATRNALHLLDIAGRTDIPVAEGSHVTITKGTKLRIADFVHGTD
GLGNQNFPAPNGKPIEQNAADFLVQQASLYPGKITVVALGPLTNIALAIQSDPDFVKNIGQIVVLGGAFSVNGNVNPAAEANIFGDPDAA
DIVFTSGADVLAVGINVTHQVVLTDFDRDELAKSNGKYAKYLDKILGVYFGYHHEAYSTKGVYLHDPTALLAAVDPSLITYTEGVVRVQT
NGITRGLTLFYNKQKRFGEVSEWSDKPSVKVAVTVDAPRVXQIGYGTAHQFLGESSXLKEKLFDILQLQIATLCLNR*
Predicted Coding Sequence 
ATGGCTACAGAACCCAAGAAGATCATCATTGACACTGATCCTGGAATTGATGATGCAATGGCGATATTTGTGGCATTGGAATCTCCTGAA
GTTGAGGTGATCGGGCTTACAACGATATATGGAAATGTCTACACAACTCTAGCTACCAGAAATGCTTTACATCTGTTGGATATAGCTGGG
AGGACAGATATTCCGGTGGCTGAAGGCTCTCATGTTACAATCACTAAAGGTACAAAACTTCGAATTGCTGATTTTGTTCATGGCACGGAT
GGACTTGGAAACCAAAACTTTCCTGCACCAAATGGAAAACCTATTGAACAGAATGCTGCTGACTTTCTTGTTCAACAAGCCAGTCTATAC
CCCGGAAAGATTACTGTTGTAGCTTTGGGTCCCTTGACAAATATAGCACTAGCCATTCAATCAGATCCTGATTTTGTTAAAAACATTGGA
CAAATTGTTGTTCTTGGTGGTGCCTTTTCTGTAAACGGAAATGTCAATCCAGCTGCTGAGGCGAATATCTTTGGAGATCCAGATGCTGCT
GATATTGTATTTACTAGCGGTGCTGATGTTCTAGCAGTTGGAATAAATGTTACACATCAAGTTGTCCTTACTGATTTTGATCGAGACGAG
TTGGCAAAGTCTAACGGAAAGTATGCCAAGTACCTTGACAAGATCTTGGGTGTCTATTTTGGCTATCACCACGAGGCATACAGCACAAAA
GGTGTTTACCTTCATGATCCAACTGCTCTGCTTGCTGCTGTTGATCCCTCACTAATCACCTATACAGAAGGTGTGGTTCGTGTCCAAACA
AATGGCATCACAAGGGGTCTGACTCTATTTTATAACAAACAAAAGAGGTTTGGTGAAGTCAGTGAATGGTCTGATAAACCCTCAGTAAAA
GTGGCAGTAACTGTTGATGCTCCTAGAGTTXCTCAAATTGGTTATGGAACGGCTCATCAATTCTTAGGAGAATCTAGTXTGCTGAAAGAG
AAGCTATTTGACATACTCCAGCTGCAGATTGCAACTCTGTGCTTGAATCGTTGA
Edits in Original Sequence 
AAAGTTTCCACTTTCCTCTTCATTCATCAATCATCATCATCCCGATCCCAGATCCATTCAACTTCCAATTCAGATTCACAAA(5')ATGG
CTACAGAACCCAAGAAGATCATCATTGACACTGATCCTGGAATTGATGATGCAATGGCGATATTTGTGGCATTGGAATCTCCTGAAGTTG
AGGTGATCGGGCTTACAACGATATATGGAAATGTCTACACAACTCTAGCTACCAGAAATGCTTTACATCTGTTGGATATAGCTGGGAGGA
CAGATATTCCGGTGGCTGAAGGCTCTCATGTTACAATCACTAAAGGTACAAAACTTCGAATTGCTGATTTTGTTCATGGCACGGATGGAC
TTGGAAACCAAAACTTTCCTGCACCAAATGGAAAACCTATTGAACAGAATGCTGCTGACTTTCTTGTTCAACAAGCCAGTCTATACCCCG
GAAAGATTACTGTTGTAGCTTTGGGTCCCTTGACAAATATAGCACTAGCCATTCAATCAGATCCTGATTTTGTTAAAAACATTGGACAAA
TTGTTGTTCTTGGTGGTGCCTTTTCTGTAAACGGAAATGTCAATCCAGCTGCTGAGGCGAATATCTTTGGAGATCCAGATGCTGCTGATA
TTGTATTTACTAGCGGTGCTGATGTTCTAGCAGTTGGAATAAATGTTACACATCAAGTTGTCCTTACTGATTTTGATCGAGACGAGTTGG
CAAAGTCTAACGGAAAGTATGCCAAGTACCTTGACAAGATCTTGGGTGTCTATTTTGGCTATCACCACGAGGCATACAGCACAAAAGGTG
TTTACCTTCATGATCCAACTGCTCTGCTTGCTGCTGTTGATCCCTCACTAATCACCTATACAGAAGGTGTGGTTCGTGTCCAAACAAATG
GCATCACAAGGGGTCTGACTCTATTTTATAACAAACAAAAGAGGTTTGGTGAAGTCAGTGAATGGTCTGATAAACCCTCAGTAAAAGTGG
CAGTAACTGTTGATGCTCCTAGAGTTXCTCAAATTGGTTATGGAACGGCTCATCAATTCTTAGGAGAATCTAGTXTGCTGAAAGAGAAGC
TATTTGACATACTCCAGCTGCAGATTGCAACTCTGTGCTTGAATCGTTGA(3')TATTTTTTTGAATTCTGTTCTGATGTGAAGAGGAAG
ATGATAAGAAGATTACCTTCATACTATGATTATGGGATATAGTCGATCACCAAGAAGAATTTCATTTTGTTTTAAGCTTCTATGCCATCT
CCACAGATGTTGTAATAAAATCTATAGTTTCTGAAGCTCCCTTTGAATAAAGTGATCTGCAGAACCCAACAGTCATCATTTTAGAAAAAT
AAACATCTTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan