ESTScan Details for Unigene SGN-U583683

Score 
1617
Direction 
Forward
Predicted Peptide Sequence 
MASEIEVVEEVESRNEDESSTSTAVVNGGVGEEESLRDDVYTAAAYGDMEKLQRLVESEGCSVSEPDGLGYYALQWAALNNRTAAAQYII
EHGGDVNAADHTGQTALHWSAVRGAVQVAELLLQEGGRVNAADMYGYQPTHVAAQYGQTAFLYYVVTKWNADPDVPDSDGRSPLHWAAYK
GFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGHLEACTVLVQAGKKEDLIVTDNTGLTPAQLASDKSHRQVAFFLGNARQLYDKRCDG
STRLGKLSKLGLAPVLCCTIFLLLTTYIHAVILASTLPKLTAAGALFAWLGVFLATAGLVTFYRCSRKDPGYXPEESADSQNIKDDEPLL
KMEMNHPALLAGNWSQLCSTCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFIFLVLEVLAMVLTGAVTLTRVLTDPAAP
SSFGAWLSHAGTHHVGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYLRGPGGRFRNPYDHGCKKNCSDFLINGYNED
IECVEESVESEGIGMMQIPHSSSMQNGTGHSHQINGNGHHVINISNNNQNSHQAHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARAALP
S*
Predicted Coding Sequence 
ATGGCATCGGAGATCGAGGTGGTGGAGGAGGTTGAATCGAGAAATGAAGATGAATCATCGACGTCTACGGCGGTGGTTAACGGTGGTGTA
GGTGAGGAGGAGAGTTTGAGGGATGATGTGTATACGGCAGCGGCGTATGGGGATATGGAGAAACTTCAGAGATTGGTGGAAAGTGAGGGT
TGTTCTGTGTCTGAGCCTGATGGTCTTGGTTACTATGCGCTTCAGTGGGCTGCTCTTAATAATCGCACCGCAGCTGCACAATATATTATT
GAGCACGGAGGAGATGTAAATGCTGCAGATCATACGGGGCAAACAGCATTGCACTGGAGTGCTGTTCGAGGTGCAGTGCAGGTTGCTGAG
CTCTTACTACAAGAAGGTGGTCGTGTAAATGCAGCTGATATGTATGGCTATCAGCCAACACATGTTGCCGCACAGTATGGTCAGACAGCT
TTCCTTTACTATGTTGTTACAAAGTGGAATGCTGATCCTGATGTACCTGACAGTGACGGGAGAAGCCCTTTACACTGGGCTGCATACAAG
GGTTTTGCTGACTGTATACGCCTTCTACTCTTTCTTGATGCATATCGTGGACGTCAGGATAAAGAGGGTTGTACTCCTCTTCACTGGGCT
GCTATTAGGGGTCACCTAGAAGCATGTACGGTGTTGGTGCAGGCAGGGAAGAAGGAAGACCTTATCGTGACAGATAACACTGGCCTTACA
CCTGCTCAGCTTGCTTCTGACAAGAGTCACAGACAAGTTGCTTTTTTCCTTGGAAACGCTAGGCAGTTATATGACAAACGCTGTGACGGA
AGTACCCGGCTTGGCAAACTTTCAAAGCTTGGACTTGCTCCTGTTCTTTGTTGTACAATATTTCTTCTACTTACCACTTACATTCATGCG
GTAATTTTGGCTTCAACTTTGCCAAAATTAACTGCTGCTGGCGCACTATTTGCATGGTTGGGAGTTTTCCTTGCTACAGCTGGACTAGTT
ACATTTTACCGGTGCAGCAGAAAAGATCCAGGTTACATXCCGGAGGAGTCAGCTGATTCACAAAATATCAAAGATGATGAACCTTTGCTC
AAAATGGAAATGAATCATCCTGCTTTGCTTGCTGGGAATTGGTCTCAGCTTTGCTCCACGTGCAAGATTGTTCGTCCTCTTCGTGCAAAG
CATTGTTCAACCTGCGATCGTTGTGTGGAACAATTTGATCATCATTGTCCATGGGTGTCTAATTGCATCGGCAAGAAAAACAAGTGGGAC
TTTTTCATCTTTCTTGTTCTCGAAGTATTGGCAATGGTCTTAACTGGTGCAGTTACTCTTACAAGAGTCTTGACTGACCCAGCAGCTCCA
TCATCGTTTGGGGCTTGGCTGAGTCATGCCGGTACTCACCATGTTGGTGCTTTAGCATTTTTATTTGCAGACTTCTTCCTCTTCGTTGGA
GTGGCAGTCTTAACTGGGGTACAAGCTTCTCAGATATCACACAACATTACAACAAATGAAATGGCCAATATGATGCGTTACAGTTACCTC
AGAGGACCAGGTGGTCGATTCCGTAATCCATATGATCATGGGTGTAAGAAGAACTGTTCAGATTTCTTGATAAACGGTTACAACGAAGAC
ATTGAGTGTGTTGAAGAATCGGTTGAGTCCGAAGGGATTGGAATGATGCAGATTCCTCACAGTTCAAGTATGCAAAACGGCACCGGCCAT
TCTCATCAGATCAATGGAAATGGCCATCATGTTATCAATATAAGCAACAATAACCAGAACTCACACCAGGCCCATGTTCATTCTGCCCAT
TGTAGTCATAATGTGAAGAGCAAAACTGATTCTGTACCTGTGGGTTTGGGTGTTGGCTTAGGAAGAAACGCCGCGCGTGCCGCGCTACCT
TCATAA
Edits in Original Sequence 
AGCAATTTGTCTTTCTGGTGATTTGGTGTTTGTTTTCTCCATACCGAGTCAACCCTCTTCCTCCTTCCCAGAAAAACCCTAGAATCTCCA
TTCATTCTCACGTTCAAATTATATATATATATTGAATCCAATTTCATAGTCAAATTTTTCATATTGATTCAGAA
(5')ATGGCATCGGAG
ATCGAGGTGGTGGAGGAGGTTGAATCGAGAAATGAAGATGAATCATCGACGTCTACGGCGGTGGTTAACGGTGGTGTAGGTGAGGAGGAG
AGTTTGAGGGATGATGTGTATACGGCAGCGGCGTATGGGGATATGGAGAAACTTCAGAGATTGGTGGAAAGTGAGGGTTGTTCTGTGTCT
GAGCCTGATGGTCTTGGTTACTATGCGCTTCAGTGGGCTGCTCTTAATAATCGCACCGCAGCTGCACAATATATTATTGAGCACGGAGGA
GATGTAAATGCTGCAGATCATACGGGGCAAACAGCATTGCACTGGAGTGCTGTTCGAGGTGCAGTGCAGGTTGCTGAGCTCTTACTACAA
GAAGGTGGTCGTGTAAATGCAGCTGATATGTATGGCTATCAGCCAACACATGTTGCCGCACAGTATGGTCAGACAGCTTTCCTTTACTAT
GTTGTTACAAAGTGGAATGCTGATCCTGATGTACCTGACAGTGACGGGAGAAGCCCTTTACACTGGGCTGCATACAAGGGTTTTGCTGAC
TGTATACGCCTTCTACTCTTTCTTGATGCATATCGTGGACGTCAGGATAAAGAGGGTTGTACTCCTCTTCACTGGGCTGCTATTAGGGGT
CACCTAGAAGCATGTACGGTGTTGGTGCAGGCAGGGAAGAAGGAAGACCTTATCGTGACAGATAACACTGGCCTTACACCTGCTCAGCTT
GCTTCTGACAAGAGTCACAGACAAGTTGCTTTTTTCCTTGGAAACGCTAGGCAGTTATATGACAAACGCTGTGACGGAAGTACCCGGCTT
GGCAAACTTTCAAAGCTTGGACTTGCTCCTGTTCTTTGTTGTACAATATTTCTTCTACTTACCACTTACATTCATGCGGTAATTTTGGCT
TCAACTTTGCCAAAATTAACTGCTGCTGGCGCACTATTTGCATGGTTGGGAGTTTTCCTTGCTACAGCTGGACTAGTTACATTTTACCGG
TGCAGCAGAAAAGATCCAGGTTACATXCCGGAGGAGTCAGCaTGATTCACAAAATATCAAAGATGATGAACCTTTGCTCAAAATGGAAAT
GAATCATCCTGCTTTGCTTGCTGGGAATTGGTCTCAGCTTTGCTCCACGTGCAAGATTGTTCGTCCTCTTCGTGCAAAGCATTGTTCAAC
CTGCGATCGTTGTGTGGAACAATTTGATCATCATTGTCCATGGGTGTCTAATTGCATCGGCAAGAAAAACAAGTGGGACTTTTTCATCTT
TCTTGTTCTCGAAGTATTGGCAATGGTCTTAACTGGTGCAGTTACTCTTACAAGAGTCTTGACTGACCCAGCAGCTCCATCATCGTTTGG
GGCTTGGCTGAGTCATGCCGGTACTCACCATGTTGGTGCTTTAGCATTTTTATTTGCAGACTTCTTCCTCTTCGTTGGAGTGGCAGTCTT
AACTGGGGTACAAGCTTCTCAGATATCACACAACATTACAACAAATGAAATGGCCAATATGATGCGTTACAGTTACCTCAGAGGACCAGG
TGGTCGATTCCGTAATCCATATGATCATGGGTGTAAGAAGAACTGTTCAGATTTCTTGATAAACGGTTACAACGAAGACATTGAGTGTGT
TGAAGAATCGGTTGAGTCCGAAGGGATTGGAATGATGCAGATTCCTCACAGTTCAAGTATGCAAAACGGCACCGGCCATTCTCATCAGAT
CAATGGAAATGGCCATCATGTTATCAATATAAGCAACAATAACCAGAACTCACACCAGGCCCATGTTCATTCTGCCCATTGTAGTCATAA
TGTGAAGAGCAAAACTGATTCTGTACCTGTGGGTTTGGGTGTTGGCTTAGGAAGAAACGCCGCGCGTGCCGCGCTACCTTCATAA(3')C
CTAGTGTGCCGTTGGCTTTTTTTGGGTATTTAGAATCCCTTCTTTTTGACCTTTTATTTGTTTATATATGCTTCACACACACTCGTTTTA
GAGCTTAAGTTATTCATTTGGTTTACCATTTGTTTCCTCCCCAAAGTCTTACTTTGTACAAAGTTGTGATTCTTTTGCAGAAAAAAGGAT
TTGCAGCTGTTAGTAATCCATTTGAGAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan