ESTScan Details for Unigene SGN-U583818

Score 
554
Direction 
Forward
Predicted Peptide Sequence 
MEPANLGNLRGSSLRGSISGSRRGSVSLRANSNSIWRNTGVEIFSRSARDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGAAAEIDIDD
IGLQERKNLLERLVRVADEDNEKFLLKLKNRIDRYXSSLFDSNLAFES*
Predicted Coding Sequence 
ATGGAGCCTGCAAATTTGGGTAATTTGAGAGGTAGTAGTTTAAGAGGAAGTATAAGTGGAAGTAGAAGAGGAAGTGTAAGCTTAAGAGCA
AATAGTAATTCCATATGGAGAAATACTGGGGTTGAGATATTTTCAAGATCAGCTAGAGATGAAGATGATGAAGAAGCATTAAAATGGGCA
GCACTTGAAAAATTACCAACTTTTGATAGATTAAGAAAAGGTTTATTGTTTGGTTCACAAGGTGCTGCTGCTGAAATTGATATTGATGAT
ATTGGTTTACAAGAAAGAAAAAATTTACTTGAAAGACTTGTTAGAGTTGCTGATGAAGATAATGAAAAGTTCTTGTTGAAACTCAAAAAC
AGGATTGATAGGTATGXTTCATCTTTGTTTGATTCAAATCTCGCGTTCGAATCCTGA
Edits in Original Sequence 
TCACAACCAAAAAAAAAAAAAAAAAATTCTTTTGAATTTTTTTTAACAACCCCATTTTCTAATTTGTGATGATTTGAAGTTTTTCTTAGT
TAATTTTTGAAAAAAAATTGAATCTTGATTTTTGTTTTTTTAATTTTAAGAATTTGGGGTTTCCAAAAA
(5')ATGGAGCCTGCAAATTT
GGGTAATTTGAGAGGTAGTAGTTTAAGAGGAAGTATAAGTGGAAGTAGAAGAGGAAGTGTAAGCTTAAGAGCAAATAGTAATTCCATATG
GAGAAATACTGGGGTTGAGATATTTTCAAGATCAGCTAGAGATGAAGATGATGAAGAAGCATTAAAATGGGCAGCACTTGAAAAATTACC
AACTTTTGATAGATTAAGAAAAGGTTTATTGTTTGGTTCACAAGGTGCTGCTGCTGAAATTGATATTGATGATATTGGTTTACAAGAAAG
AAAAAATTTACTTGAAAGACTTGTTAGAGTTGCTGATGAAGATAATGAAAAGTTCTTGTTGAAACTCAAAAACAGGATTGATAGGTATGX
TTCATCTTTGTTTGATTCAAATCTCGCGTTCGAATCCTGA(3')ATATTAAATACTTGTACTATTTTCTTCCGACCCCACTTTGTGAAAC
TACACTGAACTTGTAGTTGTTGTTGGGTGGGAAGTTAAATTTTGTTTTTTTTTAATGGTTACCATAGATGTTGTCTACGATTCATATTGA
ATCCGACTTATTTGGAATCACATAGTATAAGTCGGAAATGTCTTTATATAAGGATTTTTTTTTTATAATCAGAGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan