Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U583821

Score 
459
Direction 
Forward
Predicted Peptide Sequence 
MNPQDDISNSVGLHMYPKHYRGLELHLSVHCSAHHFGKLFFRRPIVLSLPGAFGLPLIPNSVFGGGASSEMGATNPGLPSSITASTNPYS
LDSQAFIKLSRSVSTSIFSKGWPVTLDSILLSFIFWYPISQKMLLPSSSYGPFPWYPDYSIPCDSSKSFADTLKALGVKAECILYEGKTH
TDLFLQDPMRGGIDDMLDDLITLIHGDSSETIKAKSTPRKRLVPEFMLQMARSVSPF*RSFYYCSKPIVFNWTRFELHEXARAFD*
Predicted Coding Sequence 
ATGAATCCTCAAGACGACATCTCAAATTCAGTAGGACTACACATGTATCCCAAACATTATAGAGGACTGGAGCTTCATCTTTCTGTTCAT
TGCTCTGCTCATCATTTTGGAAAACTTTTCTTCAGAAGGCCAATTGTTCTTTCTCTTCCTGGTGCCTTCGGCCTTCCACTTATACCAAAC
TCTGTTTTTGGTGGAGGTGCGTCATCGGAAATGGGTGCTACCAATCCTGGTTTGCCGTCATCTATAACAGCATCAACCAACCCGTATTCC
TTAGACTCCCAAGCATTCATAAAATTATCACGATCAGTATCCACTTCAATCTTTTCTAAAGGCTGGCCTGTAACTCTTGATAGTATTTTA
TTAAGCTTCATCTTCTGGTATCCCATTTCTCAAAAGATGCTTCTCCCTTCTTCCTCCTATGGTCCTTTTCCATGGTACCCAGATTATTCC
ATTCCGTGTGATTCCAGCAAGAGTTTTGCTGATACTCTTAAAGCTCTCGGTGTCAAAGCAGAATGTATCCTATATGAAGGAAAGACACAT
ACAGATTTGTTTCTTCAGGATCCAATGAGAGGTGGAATAGATGATATGTTAGATGATCTAATTACACTGATTCATGGTGATAGCTCTGAA
ACCATCAAAGCAAAATCGACCCCAAGAAAACGCCTTGTACCTGAGTTCATGTTGCAGATGGCTCGAAGTGTTAGCCCCTTTTAACGATCA
TTCTACTACTGTTCCAAACCCATTGTGTTCAATTGGACTCGTTTTGAGCTCCATGAAXTCGCCAGAGCTTTCGATTAG
Edits in Original Sequence 
TTTTTTTTTTACCATTTCAAATGTTCTCTTTGTTGATAAACGACTAGTTCAAATACTAAGAGGAGACACTGATACAACAGAACGCTCAAC
TGACGTCGACCATAATATAAAAAATACTGCAATAATCTACA
(5')ATGAATCCTCAAGACGACATCTCAAATTCAGTAGGACTACACATG
TATCCCAAtACATTATAGAGGACTGaGAGCTTCATCTTTCTGTTCATTGCTCTGCTCATCATTTTGGAAtAACTTTTCTTCAGAAGGCCA
ATTGTTCTTTCTCTTCCTGGTGCCTTCGGCCTTCCACTTATACCAAACTCgTGTTTTTGGTGGAGGTGCGTCATCGGAAATGGGTGCTAC
CAATCCTGGTTTGCCGTCATCTATAACAGCATCAACCAACCCGTATTCCTTAGACTCCCAAGCATTCATAAAATTATCACGATCAGTATC
CACTTCAATCTTTTCTAAAGGCTGGCCTGTAACTCTTGATAGTATTTTATTAAGCTTCATCTTCTGGTATCCCATTTCTCAAAAGATGCT
gTCTCCCTTCTTCCTCCTATGGTCCTTTTCCATGGTACCgCAGATTATTCCATTCCGTGTGATTCCAGCAAGAGTTTTGCTGATACTCTT
AAAGCTCTCGGTGTCAAAGCAGAATGTATCCTATATGAAGGAAAGACACATACAGATTTGTTTCTTCAGGATCCAATGAGAGGTGGAATA
GATGATATGTTAGATGATCTAATTACACTGATTCATGGTGATAGCTCTGAAACCATCAAAGCAAAATCGACCCCAAGAAAACGCCTTGTA
CCTGAGTTCATGTTGCAGATGGCTCGAAGTGTTAGCCCCTTTTAACGATCATTCTACTACTGTTCCAtAACCCATTGTGTTCAATTGGAC
TCGTTTTGAGCTCCATGAAXTCGCCAGAGCTTTCGATTAG(3')ATCCTCTTTTTTCCTTGTTATAGTTAGTTTAAAGTGGACTTGCTAA
CAAAAGTAGCCATATATACAAATAGGTTATTCTTGGAAGGGAAAAAACCCTTCATTCAATTAGTCTTATTGTAATATACTTAATACTTCC
AAGTTTTTACCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan