ESTScan Details for Unigene SGN-U583864

Score 
571
Direction 
Reverse
Predicted Peptide Sequence 
MQVIPKWRNXFDLEEFTYSIHKNSIFYTITKYPFELFPFDLKCFEKWKNKWNSDFRGSQQPTKNYIRYETRQKRADSKKALKNLLFYGAS
GNSFENESSTINDRWDMDRDDRSEKKSEYKSAARLRDRSRRRMRKMKKRRLYEEFDEYPESVFEATFGDKWYTWSFRPGKSSTFEDMFPE
DKKQTGQNKGITDGDNETENETHTESKYESCHIGSSSERTILGLPPRGPLKIEDVKNAFRLSALKWHPDKHQGPSQAAAEEKFKTCVTAY
KSLCNAFSPA*
Predicted Coding Sequence 
ATGCAAGTAATACCCAAATGGCGTAATGXTTTTGATCTTGAAGAATTCACTTATTCAATCCACAAGAATAGTATCTTCTACACAATCACA
AAATACCCATTTGAGCTCTTTCCATTCGACCTCAAATGCTTTGAGAAATGGAAAAATAAGTGGAATTCTGATTTTAGAGGAAGTCAGCAG
CCAACTAAGAATTATATCAGATATGAAACACGTCAAAAGCGTGCTGACTCAAAAAAAGCTTTGAAAAATCTTCTCTTTTATGGGGCATCT
GGAAACTCTTTTGAGAATGAATCTTCAACAATAAATGATAGATGGGATATGGATCGGGATGATCGTTCAGAGAAGAAAAGTGAATATAAG
TCCGCTGCTCGTCTTAGAGATCGCTCAAGGAGAAGGATGCGAAAAATGAAGAAACGGAGATTATATGAAGAATTCGATGAATATCCTGAA
TCAGTATTCGAAGCAACTTTTGGTGATAAGTGGTACACTTGGTCTTTTAGGCCTGGTAAATCATCTACTTTTGAAGATATGTTCCCCGAA
GACAAGAAACAGACTGGTCAGAACAAAGGCATTACAGATGGXGATAATGAAACTGAAAACGAGACACATACAGAATCCAAATATGAATCG
TGTCATATAGGTTCTTCCTCAGAAAGAACAATTCTCGGTTTGCCCCCAAGAGGTCCTCTGAAGATTGAGGATGTCAAGAATGCTTTCCGC
TTATCAGCATTAAAGTGGCATCCTGATAAACATCAAGGCCCTTCACAGGCAGCAGCAGAAGAGAAATTCAAAACTTGTGTCACTGCATAC
AAGTCATTGTGCAACGCGTTCTCCCCAGCTTAA
Edits in Original Sequence 
CAAGCAACTAAAAAACACCATTGATGATTCATTCTTTGTACAAAAAGATCGGGAAAAAAAAAGTTCAGTTTTTTATCTTTGGTATTTCAC
TTTTTGGGTCGTTTTCAAATTTTTAAGAAA
(5')ATGCAAGTAATACCCAAATGGCGTAATGXTTTTGATCTTGAAGAATTCACTTATTC
AATCCACAAGAATAGTATCTTCTACACAATCACAAAATACCCATTTGAGCTCTTTCCATTCGACCTCAAtATGCTTTGAGAAATGGAAAA
ATAAGTGGAATTCTGATTTTAGAGGAAGTCAGCAGCCAACTAAGAATTATATCAGATATGAAACACGTCAAAAGCGTGCTGACTCAAAAA
AAGCTTTGAAAAATCTTCTCTTTTATGGGGCATCTGGAAACTCTTTTGAGAATGAATCTTCAACAATAAATGATAGATGGGATATGGATC
GGGATGATCGTTCAGAGAAGAAAAGTGAATATAAGTCCGCTGCTCGTCTTAGAGATCGCTCAAGGAGAAGGATGCGAAAAATGAAGAAAC
GGAGATTATATGAAGAATTCGATGAATATCCTGAATCAGTATTCGAAGCAACTTTTGGTGATAAGTGGTACACTTGGTCTTTTAGGCCTG
GTAAATCATCTACTTTTGAAGATATGTTCtCCCGAAGACAAGAAACAGACTGGTCAGAACAAAGGCATTACAGATGGXGATAATGAAACT
GAAAACGAGACACATACAGAATCCAAATATGAATCGTGTCATATAGGTTCTTCCTCAGAAAGAACAATTCTCGGTTTGCCCCCAAGAGGT
CCTCTGAAGATTGAGGATGTCAAGAATGCTTTCCGCTTATCAGCATTAAAGTGGCATCCTGATAAACATCAAGGCCCTTCACAGGCAGCA
GCAGAAGAGAAATTCAAAACTTGTGTCACTGCATACAAGTCATTGTGCAACGCGTTCTCCCCAGCTTAA(3')CCTTTATCTGACGTATC
TATGGCTTCTTTTCTTGGGAGTTTCAGAAGCCAACATCACCATTCTTAGTATAATAGCTAGCTAGCTAGCTGAGTGTTATGTGTTCTAAT
TTAGCTCTTGCAATAATGGGGGCTCTTTCTTTCCCAGCAGAGTCGTCATGAAAATGTATTTAATAAAATTTTGGAGTCTTGTATACAACC
AAACATCCATGCATAACATACCCTAGTTGCTTGGTTTCTGAAAATAGGATGTTATCATACCTGTATTATCGCATCGAATTTCATCAGAAT
TTTGAAGTTATAAGTGTACTACATAGTCATAACTATCGTGGAAATTATACATTGACTATACATAATAATGGTTTTTTTTAAAAGATATAA
TATTTTTCTCGATAGGTGCTTGTACTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan