ESTScan Details for Unigene SGN-U583889

Score 
2006
Direction 
Forward
Predicted Peptide Sequence 
MAMAITTLTLGLDYPFDFLTSSLFLLYISTLNTAIKIHLMASVKSSRSRAHAVTQSKGINKDTGPKLEENLNVFKSDNFDADAFXPVQMS
FSQREGNKAAVLLSIGTEKASAEEMRRSVYANYTAFIRTSKEISDLEGELSSMKNLLSTQATLIHGLAEGVHIDSLSDVVPESTSDSSPT
ADVREPSDLEKWLTEFPDHLDVLLAERRVDEALLSLDEGERVASDAKEKKTLGHAVLLSLQTAIAERKQKLADHLAEIACQPSTRGAELR
AAISALKKLGDGPRAHSLLLNAHYQKYQFNMKNLRPSSTSYGGAYTAALSQLVFSGIAQAATDSLAIFGKEPAYTSELVMWSTKQTEAFA
LLVKRHALTSSAAAGGLRAAAECVQIALGHCSLLEARGLALCPVLLKLFRPSVEQALDANLKRIEESTAALAAADDWELTYPPSVTRASG
RSAGAVPGSTRAYHHKLSSSAHRFNLMVQDFFEDVGPLLTMQLGGKALEGLFQVFNTYVNTLVRALPGSMEDEPAMKIHGIKIVRMAETE
AQQIALLANASLLADELLPRAAMKLAPLANQKDDLQRRASDRQSRHPEQREWKKRLVNSVDRLKDSFCQQHALDLIFTEEGDSHLTAEMY
INMEGNADDMEWSPSLIFQELYVKLNRMAAIAADMFVGRERFAMLLLMRLTETVILWLSQDQSFWDDIEEGPRPLGHLGLQQFYLDMKFV
TCFASQGRYLSRNLLRVVNDIISKAMSAFAATGMDPYSVLPEDEWFTEIAQDAMEKLSGKPKVANGERDLNSPTASVSAQSMSSVRSHGS
Y*
Predicted Coding Sequence 
ATGGCGATGGCGATAACAACTCTCACCTTAGGATTAGACTACCCTTTTGATTTTCTTACGTCTTCCCTATTTTTGCTCTATATTTCAACC
CTAAACACCGCCATTAAGATTCACCTCATGGCTTCCGTCAAATCCTCTCGTTCAAGAGCTCATGCGGTCACTCAGTCTAAAGGAATCAAC
AAGGATACCGGCCCCAAGCTCGAAGAAAATCTTAACGTCTTCAAATCCGACAATTTCGATGCTGATGCTTTTGXTCCAGTCCAAATGTCA
TTCTCTCAACGAGAAGGAAATAAGGCAGCTGTGCTCTTATCTATTGGAACTGAAAAGGCTTCTGCTGAGGAAATGCGCAGAAGTGTCTAT
GCCAATTATACAGCTTTCATTCGCACATCAAAAGAGATATCAGATTTGGAGGGTGAACTCTCATCCATGAAAAACTTGCTATCTACTCAG
GCAACTTTAATTCATGGTTTAGCTGAGGGAGTTCATATTGATTCTTTGTCTGATGTTGTTCCCGAGTCCACGTCCGATAGCTCTCCTACT
GCTGACGTTAGGGAGCCTTCAGACCTAGAGAAGTGGCTTACGGAGTTTCCTGATCACCTGGATGTTCTATTAGCTGAAAGGAGAGTAGAT
GAAGCCTTGTTGAGTCTTGATGAAGGAGAACGCGTAGCATCTGATGCAAAAGAGAAAAAAACGTTAGGTCATGCTGTGCTGTTGTCACTA
CAAACTGCCATTGCTGAACGTAAGCAAAAACTGGCTGATCACCTTGCTGAAATTGCCTGTCAACCTTCTACTCGTGGTGCAGAGCTTCGT
GCTGCTATTTCAGCTCTTAAAAAGCTCGGGGATGGCCCCCGTGCTCATAGTTTGCTCCTTAATGCACATTACCAGAAATACCAATTTAAC
ATGAAAAATCTTCGTCCATCTAGCACCTCTTATGGAGGAGCTTATACTGCCGCCCTTTCTCAGCTCGTATTCTCTGGCATTGCTCAAGCA
GCCACCGATTCATTGGCTATTTTTGGTAAAGAGCCAGCTTATACATCCGAACTAGTGATGTGGTCTACTAAGCAGACTGAGGCATTTGCA
CTTTTGGTCAAAAGACATGCATTAACTTCATCAGCAGCTGCTGGTGGCTTACGTGCTGCTGCAGAATGTGTTCAAATAGCTTTAGGACAC
TGTTCCTTGTTGGAAGCTCGTGGACTTGCACTTTGTCCTGTGCTTCTGAAGCTTTTTAGACCAAGCGTTGAGCAAGCGCTAGATGCCAAC
TTAAAACGAATTGAAGAAAGCACTGCTGCTTTGGCAGCTGCTGATGATTGGGAACTCACATATCCACCGTCTGTTACACGCGCATCCGGT
AGGTCAGCTGGTGCTGTTCCTGGTTCTACAAGGGCATATCACCATAAACTTTCAAGTAGTGCGCACCGATTCAATTTGATGGTTCAAGAT
TTCTTTGAGGACGTGGGACCATTGCTAACTATGCAGTTGGGAGGGAAAGCTTTGGAAGGTCTATTTCAAGTGTTTAATACATACGTGAAC
ACACTTGTAAGAGCATTACCTGGCTCCATGGAGGATGAACCAGCTATGAAAATTCACGGAATAAAAATTGTTAGAATGGCTGAGACTGAA
GCTCAACAAATTGCTTTGCTTGCAAATGCATCTCTATTGGCGGACGAACTATTGCCACGTGCAGCTATGAAGCTTGCTCCCTTGGCTAAT
CAAAAGGATGATCTTCAACGAAGAGCTTCAGATAGGCAAAGCCGTCACCCTGAGCAAAGGGAATGGAAAAAGCGTCTGGTGAACTCAGTC
GACCGATTAAAGGATAGCTTTTGTCAGCAACATGCTCTGGATCTTATTTTCACTGAGGAAGGGGACAGCCATCTCACTGCAGAAATGTAT
ATAAACATGGAGGGAAATGCAGACGATATGGAATGGTCGCCTTCTCTAATATTTCAGGAACTTTATGTCAAACTAAACAGAATGGCTGCC
ATAGCTGCTGATATGTTTGTGGGAAGGGAAAGATTTGCTATGTTGTTGTTGATGAGGCTTACAGAAACTGTCATCTTGTGGCTTTCACAA
GATCAGAGCTTTTGGGATGACATAGAGGAAGGACCAAGGCCATTGGGTCATCTTGGTCTTCAGCAGTTCTATTTGGATATGAAGTTTGTC
ACATGCTTTGCTTCGCAAGGACGCTACTTATCTAGAAATTTGCTTCGGGTTGTCAATGACATAATCTCTAAAGCTATGTCAGCCTTTGCT
GCAACAGGGATGGATCCATATAGTGTTCTCCCTGAGGATGAATGGTTTACTGAAATTGCTCAAGATGCGATGGAGAAGCTGAGTGGAAAG
CCCAAAGTTGCTAATGGGGAAAGGGACCTGAACAGTCCAACAGCCTCTGTCTCTGCCCAATCTATGTCCTCTGTCAGATCTCATGGGAGT
TATTGA
Edits in Original Sequence 
GTGTACCGGGCGGGCAGTAAATAAAGATAGGTAAGAGAAAGAAAATTGGGTAGGCTGGCGATTAGCGAACCAACAACACAATCAAACAAA
TTTTTATTCTCTTTCTACGAACAACTAATAATCTCCTCTTCTTTCGTCAATC
(5')ATGGCGATGGCGATAACAACTCTCACCTTAGGAT
TAGAtCTACCCTTTTGATTTTCTTACGTCTTCCCTATTTTTGCTCTATATTTCAACCCTAAACAtCCGCCATTAAGATTCACCTCATGGC
TTCCGTCAAATCCTCTCGTTCAAGAGCTCATGCGGTCACTCAGTCTAAAGGAATCAACAAGGATACCGGCCCCAAGCTCGAAGAAAATCT
TAACGTCTTCAAATCCGACAATTTCGATGCTGATGCTTTTGXTCCAGTCCAAATGTCATTCTCTCAACGAGAAGGAAATAAGGCAGCTGT
GCTCTTATCTATTGGAACTGAAAAgGGCTTCTGCTGAGGAAATGCGCAGAAGTGTCTATGCCAATTATACAGCTTTCATTCGCACATCAA
AAGAGATATCAGATTTGGAGGGTGAACTCTCATCCATGAAAAACTTGCTATCTACTCAGGCAACTTTAATTCATGGTTTAGCTGAGGGAG
TTCATATTGATTCTTTGTCTGATGTTGTTCCCGAGTCCACGTCCGATAGCTCTCCTACTGCTGACGTTAGGGAGCCTTCAGACCTAGAGA
AGTGGCTTACGGAGTTTCCTGATCACCTGGATGTTCTATTAGCTGAAAGGAGAGTAGATGAAGCCTTGTTGAGTCTTGATGAAGGAGAAC
GCGTAGCATCTGATGCAAAAGAGAAAAAAACGTTAGGTCATGCTGTGCTGTTGTCACTACAAACTGCCATTGCTGAACGTAAGCAAAAAC
TGGCTGATCACCTTGCTGAAATTGCCTGTCAACCTTCTACTCGTGGTGCAGAGCTTCGTGCTGCTATTTCAGCTCTTAAAAAGCTCGGGG
ATGGCCCCCGTGCTCATAGTTTGCTCCTTAATGCACATTACCAGAAATACCAATTTAACATGAAAAATCTTCGTCCATCTAGCACCTCTT
ATGGAGGAGCTTATACTGCCGCCCTTTCTCAGCTCGTATTCTCTGGCATTGCTCAAGCAGCCACCGATTCATTGGCTATTTTTGGTAAAG
AGCCAGCTTATACATCCGAACTAGTGATGTGGTCTACTAAGCAGACTGAGGCATTTGCACTTTTGGTCAAAAGACATGCATTAACTTCAT
CAGCAGCTGCTGGTGGCTTACGTGCTGCTGCAGAATGTGTTCAAATAGCTTTAGGACACTGTTCCTTGTTGGAAGCTCGTGGACTTGCAC
TTTGTCCTGTGCTTCTGAAGCTTTTTAGACCAAGCGTTGAGCAAGCGCTAGATGCCAACTTAAAACGAATTGAAGAAAGCACTGCTGCTT
TGGCAGCTGCTGATGATTGGGAACTCACATATCCACCGTCTGTTACACGCGCATCCGGTAGGTCAGCTGGTGCTGTTCCTGGTTCTACAA
GGGCATATCACCATAAACTTTCAAGTAGTGCGCACCGATTCAATTTGATGGTTCAAGATTTCTTTGAGGACGTGGGACCATTGCTAACTA
TGCAGTTGGGAGGGAAAGCTTTGGAAGGTCTATTTCAAGTGTTTAATACATACGTGAACACACTTGTAAGAGCATTACCTGGCTCCATGG
AGGATGAAcCCAGCTATGAAAATTCACGGAATAAAAATTGTTAGAATGGCTGAGACTGAAGCTCAACAAATTGCTTTGCTTGCAAATGCA
TCTCTATTGGCGGACGAACTATTGCCACGTGCAGCTATGAAGCTTGCTCCCTTGGCTAATCAAAAGGATGATCTTCAACGAAGAGCTTCA
GATAGGCAAAGCCGTCACCCTGAGCAAAGGGAATGGAAAAAGCGTCTGGTGAACTCAGTCGACCGATTAAAGGATAGCTTTTGTCAGCAA
CATGCTCTGGATCTTATTTTCACTGAGGAAGGGGACAGCCATCTCACTGCAGAAATGTATATAAACATGGAGGGAAATGCAGACGATATG
GAATGGTCGCCTTCTCTAATATTTCAGGAACTTTATGTCAAACTAAACAGAATGGCTGCCATAGCTGCTGATATGTTTGTGGGAAGGGAA
AGATTTGCTATGTTGTTGTTGATGAGGCTTACAGAAACTGTCATCTTGTGGCTTTCACAAGATCAGAGCTTTTGGGATGACATAGAGGAA
GGACCAAGGCCATTGGGTCATCTTGGTCTTCAGCAGTTCTATTTGGATATGAAGTTTGTCACATGCTTTGCTTCGCAAGGACGCTACTTA
TCTAGAAATTTGCTTCGGGTTGTCAATGACATAATCTCTAAAGCTATGTCAGCCTTTGCTGCAACAGGGATGGATCCATATAGTGTTCTC
CCTGAGGATGAATGGTTTACTGAAATTGCTCAAGATGCGATGGAGAAGCTGAGTGGAAAGCCCAAAGTTGCTAATGGGGAAAGGGACCTG
AACAGTCCAACAGCCTCTGTCTCTGCCCAATCTATGTCCTCTGTCAGATCTCATGGGAGTTATTGA(3')TGTATTATTAATTTTACTGT
TGTAAAATATGGGATGTCGACTTGGTTAGAAAATGTATTGATAGAAACTTGTGTTGCGTTGGCAAATTTGTAGATTGTGGTGGATGGTAG
TGGATTTAGGAAATTCTTTGTAGTGTTGGCATTTGGAATTTGTATATCTTGATTTGATTATTTGATCTCTAATTGAAAGACACGGTTTGT
CTCTTGAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan