ESTScan Details for Unigene SGN-U584054

Score 
1062
Direction 
Forward
Predicted Peptide Sequence 
MHKEAKSSYFDMPALDVSVAFPQATPASNFPPCTSDYYQLADLLTPEEQAIRMKVRECMEKEIAPIMTKYWEKAEFPFEIIPKFGALHIA
GGTIKGYGCPGHSITGSAVAAAEVARVDASCSTFLLVHSSLAMLTIGLCGSEMQKEKYLPSLAEFDTVACWGLTEPDYGSDASGLGTTAR
KVEGGWILEGQKRWIGNSTFADILVIFARNTSTNQINGFIVKKDAPGLQCTKIENKIGLRIVQNGDILLKNVFVPDEDRLPGVNSFQDTN
KVLAVSRVMVAWQPIGITMGVYDMCHRYLKERKQFGAPLAAFQINQQKLVQMLSNIQAMILVGWRLCKLHESDKLTHGHASLGKSWITLR
ARETVALGRELLGGNGILADFHVAKAFCDLEPIYTFEGTYDINTLVTGREITGLASFKPAPVKAKESPVKNFIFSSG**
Predicted Coding Sequence 
ATGCATAAAGAGGCGAAAAGCTCTTATTTTGATATGCCAGCATTGGATGTTTCTGTTGCATTTCCTCAAGCAACTCCAGCCTCCAACTTT
CCTCCATGCACTTCAGACTACTATCAGCTTGCCGATCTGTTGACTCCTGAGGAGCAAGCCATCAGAATGAAAGTGAGGGAATGCATGGAG
AAAGAGATTGCTCCTATAATGACGAAGTATTGGGAGAAGGCAGAATTTCCATTTGAAATCATTCCAAAATTTGGTGCTTTGCACATAGCT
GGCGGCACTATCAAGGGATATGGTTGCCCAGGTCACTCAATAACTGGAAGTGCTGTTGCTGCAGCCGAAGTTGCCAGAGTTGATGCAAGC
TGCTCTACATTCCTTTTGGTGCATTCATCTTTAGCAATGCTCACTATTGGGCTATGTGGGTCTGAAATGCAAAAGGAAAAATACTTGCCA
TCATTGGCGGAATTTGACACTGTAGCTTGTTGGGGTCTAACTGAGCCTGACTATGGAAGTGATGCAAGTGGATTGGGGACTACTGCCAGA
AAGGTTGAAGGAGGTTGGATCCTTGAAGGGCAAAAGCGTTGGATAGGAAACAGCACTTTTGCCGACATATTGGTTATTTTTGCTAGAAAT
ACATCCACAAACCAGATAAACGGTTTCATAGTAAAGAAGGATGCTCCAGGATTGCAATGTACTAAAATAGAAAACAAAATTGGACTACGG
ATTGTTCAAAATGGAGACATTCTCTTAAAGAATGTTTTTGTCCCTGACGAGGATAGACTACCTGGGGTCAATTCATTCCAGGATACAAAC
AAGGTGCTTGCTGTATCGCGTGTTATGGTTGCATGGCAGCCTATTGGCATTACAATGGGTGTTTATGATATGTGTCACAGGTACTTGAAG
GAGAGGAAGCAGTTTGGAGCACCATTAGCCGCTTTCCAGATCAACCAACAGAAATTAGTCCAGATGTTGAGCAACATTCAAGCAATGATT
CTTGTTGGTTGGCGGCTATGCAAACTACACGAGAGTGATAAACTGACTCATGGTCACGCAAGTTTAGGGAAATCATGGATTACGTTGAGG
GCAAGAGAGACCGTTGCTCTCGGACGAGAACTACTAGGTGGCAACGGAATCTTGGCTGACTTTCACGTCGCAAAGGCATTTTGCGATTTG
GAGCCGATCTATACATTTGAAGGTACTTACGATATCAACACGTTGGTAACGGGTAGAGAAATTACTGGTTTGGCTAGTTTCAAGCCTGCA
CCAGTXAAGGCAAAAGAGTCGCCTGTGAAAAATTTCATCTTCTCCTCTGGGTAGTAA
Edits in Original Sequence 
TATAATCCACTTCTTTTTCCTCTTAGGGCTTTTATACTGCTTCGTTGAAAAACAAGAGATTTATTTTTCTTCGTGAAATTCTTAATCATT
CGAAACCCAGCGAAA
(5')ATGCATAAAGAGGCGAAAAGCTCTTATTTTGATATGCCAGCATTGGATGTTTCTGTTGCATTTCCTCAAGC
AACTCCAGCCTCCAACTTTCCTCCATGCACTTCAGACTACTATCAGCTTGCCGATCTGTTGACTCCTGAGGAGCAAGCCATCAGAATGAA
AGTGAGGGAATGCATGGAGAAAGAGATTGCTCCTATAATGACGAAGTATTGGGAGAAGGCAGAATTTCCATTTGAAATCATTCCAAAATT
TGGTGCTTTGCACATAGCTGGCGGCACTATCAAGGGATATGGTTGCCCAGGTCACTCAATAACTGGAAGTGCTGTTGCTGCAGCCGAAGT
TGCCAGAGTTGATGCAAGCTGCTCTACATTCCTTTTGGTGCATTCATCTTTAGCAATGCTCACTATTGGGCTATGTGGGTCTGAAATGCA
AAAGGAAAAATACTTGCCATCATTGGCGGAATTTGACACTGTAGCTTGTTGGGGTCTAACTGAGCCTGACTATGGAAGTGATGCAAGTGG
ATTGGGGACTACTGCCAGAAAGGTTGAAGGAGGTTGGATCCTTGAAGGGCAAAAGCGTTGGATAGGAAACAGCACTTTTGCCGACATATT
GGTTATTTTTGCTAGAAATACATCCACAAACCAGATAAACGGTTTCATAGTAAAGAAGGATGCTCCAGGATTGCAATGTACTAAAATAGA
AAACAAAATTGGACTACGGATTGTTCAAAATGGAGACATTCTCTTAAAGAATGTTTTTGTCCCTGACGAGGATAGACTACCTGGGGTCAA
TTCATTCCAGGATACAAACAAGGTGCTTGCTGTATCGCGTGTTATGGTTGCATGGCAGCCTATTGGCATTACAATGGGTGTTTATGATAT
GTGTCACAGGTACTTGAAGGAGAGGAAGCAGTTTGGAGCACCATTAGCCGCTTTCCAGATCAACCAACAGAAATTAGTCCAGATGTTGAG
CAACATTCAAGCAATGATTCTTGTTGGTTGGCGGCTATGCAAACTACACGAGAGTGATAAACTGACTCATGGTCACGCAAGTTTAGGGAA
ATCATGGATTACGTTGAGGGCAAGAGAGACCGTTGCTCTCGGACGAGAACTACTAGGTGGCAACGGAATCTTGGCTGACTTTCACGTCGC
AAAGGCATTTTGCGATTTGGAGCCGATCTATACATTTGAAGGTACTTACGATATCAACACGTTGGTAACGGGTAGAGAAATTACTGGTTT
GGCTAGTTTCAAGCCTGCACCAGTXAAGGCAAAAGAGTCGCCTGTGAAAAATTTCATCTTCTCCTCTGGGTAGTAA(3')GTATTCTGCT
GAATAATGTTCTGTTTAAGCAATTGTAACTCTAGAATACTTCTTGTAGATTAATAAATATCATACTTTAATTTATCGATCAACATTTATA
TTTTTCTTTTTAATCTTCATGTATATCACATATCTTTTAATAATAATACTAGCAGCATATTTAAGATAATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan