ESTScan Details for Unigene SGN-U584074

Score 
1003
Direction 
Forward
Predicted Peptide Sequence 
XGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIMQMLRNIARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGKASEAMLY
FSSIGCSPLIAMNPAEFLIDLANGNITEKSIPSELEEKLLPGHHHFKKQNEGPSPADVHEYFVGAYESRVANIEKLKLLKHGLIEEDSEV
QSWPNLRDSGATWCQQFTILFGRSLKERNHEYFSSLRITQVIATAIVVGLLWWNSDTSFPERISDQAGLLFFVSVFWGFFPLFTAIFTFP
QERAMLVKERSVNMYKLSAYFIARITTDLLLDLVLPVTFLLIVYFMVGLKLTFNAFCLTLLTILLSIIAAQGLGLAIGAAFMDVKKATTF
ASVILMTFMLSGGFFVQEVPAFMSWVRYISINYHIYRLLLKIQFKSLRNSKYGSVDDSSGVEVGAMLVMVIGYRVLAYFLLRKMKLRTSK
*
Predicted Coding Sequence 
XCAGGAGGCGAAAGAAAACGAGTATGCATTGGAAATGAAATTCTTTTGAATCCATCACTTCTGTTCTTAGATGAACCAACATCTGGTTTG
GATTCAACCACAGCACTTCGGATCATGCAGATGTTACGTAACATTGCCAGGGCTGGAAAGACAGTGGTAACAACAATACATCAGCCATCA
AGTAGATTATTCAGCAGATTCGATAAGTTGATTCTATTAGGACAAGGCAGCTCACTGTATTTTGGCAAAGCCTCTGAGGCAATGCTGTAT
TTCTCTTCAATTGGTTGTTCTCCCCTTATAGCCATGAATCCAGCAGAGTTTCTAATTGATCTTGCAAATGGAAACATAACGGAAAAGTCT
ATACCTTCAGAACTAGAGGAGAAACTTTTACCAGGACACCATCATTTCAAAAAGCAAAATGAAGGACCTTCCCCAGCTGATGTTCATGAG
TATTTCGTTGGGGCTTATGAGTCGAGGGTTGCCAACATAGAGAAACTAAAACTCCTGAAGCATGGCCTGATAGAAGAAGATTCTGAAGTG
CAGAGTTGGCCTAATTTAAGAGATTCTGGTGCAACCTGGTGCCAACAGTTTACAATTCTTTTCGGGAGAAGTCTCAAGGAGCGAAACCAC
GAGTATTTCAGCAGTCTTCGGATAACTCAAGTCATAGCAACAGCTATAGTTGTTGGCTTACTATGGTGGAATTCAGATACTTCATTCCCT
GAAAGAATTTCAGATCAGGCAGGGTTGTTGTTCTTTGTTTCAGTATTTTGGGGTTTCTTTCCACTATTTACAGCAATCTTCACATTCCCA
CAAGAAAGGGCTATGTTGGTTAAAGAGAGATCAGTGAATATGTACAAGCTTAGTGCCTATTTCATAGCCAGAATCACCACTGATCTTCTC
CTGGACCTAGTGTTGCCTGTAACATTCTTGCTGATTGTCTATTTTATGGTTGGATTGAAGCTGACATTCAATGCATTTTGTCTAACTCTG
CTCACAATTTTACTAAGCATAATTGCTGCTCAGGGCTTAGGTTTGGCTATAGGTGCAGCATTCATGGATGTGAAAAAAGCAACAACTTTT
GCTTCTGTTATCCTCATGACATTCATGTTGTCTGGAGGATTCTTTGTCCAGGAAGTTCCAGCATTCATGTCATGGGTTCGTTATATCTCG
ATTAACTATCACATATACAGACTTCTCTTAAAGATTCAGTTCAAATCCTTGAGAAATTCAAAGTATGGCTCTGTTGATGACTCTAGTGGA
GTTGAAGTAGGAGCAATGTTGGTGATGGTTATTGGATATAGGGTGTTAGCCTACTTCCTCCTAAGAAAAATGAAACTAAGAACAAGCAAA
TAA
Edits in Original Sequence 
(5')XCAGGAGGCGAAAGAAAACGAGTATGCATTGGAAATGAAATTCTTTTGAATCCATCACTTCTGTTCTTAGATGAACCAACATCTGG
TTTGGATTCAACCACAGCACTTCGGATCATGCAGATGTTACGTAACATTGCCAGGGCTGGAAAGACAGTGGTAACAACAATACATCAGCC
ATCAAGTAGATTATTCAGCAGATTCGATAAGTTGATTCTATTAGGACAAGGCAGCTCACTGTATTTTGGCAAAGCCTCTGAGGCAATGCT
GTATTTCTCTTCAATTGGTTGTTCTCCCCTTATAGCCATGAATCCAGCAGAGTTTCTAATTGATCTTGCAAATGGAAACATAACGGAAAA
GTCTATACCTTCAGAACTAGAGGAGAAACTTTTACCAGGACACCATCATTTCAAAAAGCAAAATGAAGGACCTTCCCCAGCTGATGTTCA
TGAGTATTTCGTTGGGGCTTATGAGTCGAGGGTTGCCAACATAGAGAAACTAAAACTCCTGAAGCATGGCCTGATAGAAGAAGATTCTGA
AGTGCAGAGTTGGCCTAATTTAAGAGATTCTGGTGCAACCTGGTGCCAACAGTTTACAATTCTTTTCGGGAGAAGTCTCAAGGAGCGAAA
CCACGAGTATTTCAGCAGTCTTCGGATAACTCAAGTCATAGCAACAGCTATAGTTGTTGGCTTACTATGGTGGAATTCAGATACTTCATT
CCCTGAAAGAATTTCAGATCAGGCAGGGTTGTTGTTCTTTGTTTCAGTATTTTGGGGTTTCTTTCCACTATTTACAGCAATCTTCACATT
CCCACAAGAAAGGGCTATGTTGGTTAAAGAGAGATCAGTGAATATGTACAAGCTTAGTGCCTATTTCATAGCCAGAATCACCACTGATCT
TCTCCTGGACCTAGTGTTGCCTGTAACATTCTTGCTGATTGTCTATTTTATGGTTGGATTGAAGCTGACATTCAATGCATTTTGTCTAAC
TCTGCTCACAATTTTACTAAGCATAATTGCTGCTCAGGGCTTAGGTTTGGCTATAGGTGCAGCATTCATGGATGTGAAAAAAGCAACAAC
TTTTGCTTCTGTTATCCTCATGACATTCATGTTGTCTGGAGGATTCTTTGTCCAGGAAGTTCCAGCATTCATGTCATGGGTTCGTTATAT
CTCGATTAACTATCACATATACAGACTTCTCTTAAAGATTCAGTTCAAATCCTTGAGAAATTCAAAGTATGGCTCTGTTGATGACTCTAG
TGGAGTTGAAGTAGGAGCAATGTTGGTGATGGTTATTGGATATAGGGTGTTAGCCTACTTCCTCCTAAGAAAAATGAAACTAAGAACAAG
CAAATAA(3')TTGATAAGTATCATTTTTATAGTTTTAAGATCCAATTTCTACCAATAAGTTGTAACTACAACATTCTATATGTACTATG
TTCTTACTTTGTTTCATTTATTTCCTTCCTATTAGTTCTTTGATGTGGAGATGGAAATTTTGGGACAACATAGTTTGAACATTTCTTCTG
TGATTCAAATGGGCGATATTGAACTTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan