ESTScan Details for Unigene SGN-U584243

Score 
1531
Direction 
Forward
Predicted Peptide Sequence 
GELDRETTVFTDTYSLLSLLGISTAEQKKGKSLIEIQLKENKGISAMHRVASAGNTSNSVRPRKEKRLTYVLNDAGDTKHCAGVNSLAVL
KSPATDGCEYLFTGSRDGTLKRWALAEDGATCSATFESHVDWVNDAVLTGSNTLVSCSSDTTVKVWNGLSEGYCIKTLRQHSDYVTTLAS
AEKNSNVIASAGLGGEVFIWDLEAALTPTSKSGDATEEDCSNGVNGSGSSLPMTSIRPISSGNNISLQTQSQVYIPVTAKGHKESVYALA
MNESGSLLVSGGTEKVVRVWDPRTGSKTMKLKGHTDNIRALLIDSTGRFCISGSSDSMIRLWDLGQQRCVHSYAVHTDSVWSLASTPTFS
HVYSGGRDLSLYLTDLATRESVLMCTKEHPILQLALHDDGIWVATTDSSVHRWAAEVRNPQKVFQRGGSFLAGNLSFSRARVSLEGSTPV
PVYKEPSLSIPGTPGIVQHEILNNRRHVLTKDTAGTVKLWEITRGTVIHNYGEVSFEKKKEELFEMVSIPAWFTVDTKLGNLSVHLDTPQ
CFSAEMYSADLHIPGKPEDDKVNLARETLKGLLAHWLAKRKQRFGSQALANGEAPAGKDVPTRNLTASKIEVDGSADNDAAVYPPFEFSA
ACPPSIITEGSQSGPWRKKITDLDGTEDEKDMPWWVVDCVMNNGCLPGKIPNVASTYIHGGFYCSDPYPGKAEWPRILRIHKVVNYVIEK
MVLDKPLDSLNSDGAAGVSGGQVTHPANGGDGIFRTGLKPWQKLKPSIEILCSNQVLSPDMSLATVRAYIWKKPEDLILNYRVLRARDRI
LSVRSRVAGGXLSCSSKIIGRFSIQLAACCCVI*
Predicted Coding Sequence 
GGCGAACTCGATAGAGAGACTACGGTTTTCACCGATACTTATAGTCTTCTTTCACTCTTAGGAATCTCTACAGCXGAGCAGAAGAAGGGT
AAATCGCTAATTGAAATCCAATTGAAGGAAAATAAGGGGATTTCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGGTT
CGGCCTAGGAAGGAGAAGAGGTTGACTTATGTTTTGAATGATGCAGGTGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTATTG
AAGTCACCAGCAACTGATGGATGTGAATACCTATTCACTGGGAGCAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTGCC
ACCTGCTCTGCCACATTTGAGTCACATGTCGATTGGGTTAATGATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAGAC
ACCACTGTCAAGGTGTGGAATGGCTTATCTGAGGGATATTGTATTAAGACACTCCGGCAGCACTCCGATTACGTCACCACCCTTGCTTCA
GCAGAAAAAAATAGCAATGTTATTGCATCTGCTGGTCTTGGTGGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACATCT
AAGTCCGGTGATGCCACCGAAGAAGACTGTTCAAATGGTGTCAATGGTTCAGGAAGTTCATTGCCCATGACAAGCATCCGTCCTATCAGT
TCGGGCAATAACATTTCCTTGCAGACCCAGTCTCAAGTATATATTCCTGTGACTGCAAAAGGCCATAAGGAGTCCGTATATGCATTGGCA
ATGAATGAGAGTGGATCCCTTCTTGTTTCTGGTGGTACTGAGAAGGTTGTGCGCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGAAG
CTAAAAGGTCATACAGATAATATTAGGGCTCTTCTGATAGACTCCACTGGCAGGTTCTGCATATCTGGATCCTCTGATTCCATGATTAGA
CTATGGGATCTAGGTCAGCAGCGTTGCGTGCATTCTTATGCTGTGCATACGGATTCTGTATGGTCACTTGCTAGCACTCCTACGTTTAGT
CATGTTTATAGTGGTGGAAGAGACCTATCTTTATACTTGACAGATTTGGCAACAAGGGAGAGTGTATTGATGTGCACAAAGGAACACCCC
ATTTTGCAGTTAGCATTGCATGATGATGGCATTTGGGTGGCCACAACTGATTCATCTGTACATAGGTGGGCTGCAGAAGTGCGTAATCCC
CAGAAAGTTTTCCAAAGAGGGGGCTCATTCTTGGCTGGAAACTTGTCCTTTTCCCGGGCAAGGGTTTCTCTAGAAGGATCTACACCTGTT
CCTGTTTATAAAGAACCATCTCTTAGCATTCCTGGAACTCCAGGAATAGTGCAGCATGAGATTTTGAACAACAGAAGACATGTCCTGACT
AAGGATACTGCTGGAACAGTGAAGTTGTGGGAGATCACTAGAGGCACTGTGATTCACAACTATGGAGAGGTTTCATTTGAGAAGAAGAAA
GAAGAACTTTTTGAGATGGTGAGCATCCCTGCATGGTTCACTGTGGACACTAAGCTTGGAAACTTGTCTGTACATCTGGATACACCACAA
TGCTTTTCTGCTGAGATGTACTCTGCTGATCTCCACATTCCAGGGAAGCCTGAAGATGACAAGGTTAATTTGGCACGAGAAACCCTTAAA
GGGCTGTTGGCTCATTGGTTAGCCAAAAGAAAACAGAGATTTGGATCTCAAGCTTTGGCCAATGGGGAAGCCCCAGCTGGAAAGGATGTA
CCTACAAGGAATCTGACCGCGTCAAAAATTGAAGTGGACGGTAGTGCTGACAATGATGCTGCAGTATATCCTCCCTTTGAATTTTCAGCA
GCATGCCCTCCATCAATTATTACTGAGGGTTCTCAAAGTGGTCCATGGAGGAAAAAGATTACCGACTTAGATGGAACAGAAGATGAAAAG
GACATGCCATGGTGGGTAGTGGATTGTGTGATGAACAATGGTTGCCTCCCAGGGAAAATACCAAATGTAGCTTCTACTTACATCCATGGA
GGGTTCTACTGTTCAGATCCTTACCCAGGGAAAGCTGAGTGGCCTCGCATATTAAGAATTCACAAAGTCGTCAACTATGTTATAGAAAAG
ATGGTTCTTGATAAGCCACTGGATAGCCTAAACTCAGATGGAGCTGCTGGAGTGTCTGGTGGACAGGTGACACACCCAGCTAATGGAGGA
GATGGCATATTTCGGACTGGGCTGAAGCCTTGGCAAAAGCTTAAACCATCCATAGAGATATTGTGCAGTAACCAGGTCTTATCCCCTGAT
ATGAGCTTAGCGACTGTCCGTGCATATATATGGAAGAAACCTGAAGACCTTATCCTCAACTACCGGGTGTTGAGAGCAAGGGATAGGATT
CTGTCTGTCAGGTCCAGAGTAGCTGGAGGTGXATTGAGCTGCTCCTCAAAAATAATTGGAAGGTTTAGCATTCAACTGGCTGCTTGCTGC
TGTGTCATATGA
Edits in Original Sequence 
GGAGAGGAAAAAAAGAAATAGGGGAAACTCGATGAGTTCATCCCAAAGCATTGAAAAACACTAAACAAACACCTCTCTTTCTCTCT(5')
GGCGAACTCGATAGAGAGACTACGGTTTTaCACCGATACTTATAGTCTTCTTTCACTCTTAGGAATCTCTACAGCXGAGCAGAAGAAGGG
TAAATCGCTAATTGAAATCCAATTGAAGcGAAAATAAGGGGATTTCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGG
TTCGGCCTAGGAAGGAGAAGAGGTTGACTTATGTTTTGAATGATGCAGGTGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTAT
TGAAGTCACCAGCAACTGATGGATGTGAATACCTATTCACTGGGAGCAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTG
CCACCTGCTCTGCCACATTTGAGTCACATGTCGATTGGGTTAATGATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAG
ACACCACTGTCAAGGTGTGGAATGGCTTATCTGAGGGATATTGTATTAAGACACTCCGGCAGCACTCCGATTACGTCACCACCCTTGCTT
CAGCAGAAAAAAATAGCAATGTTATTGCATCTGCTGGTCTTGGTGGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACAT
CTAAGTCCGGTGATGCCACCGAAGAAGACTGTTCAAATGGTGTCAATGGTTCAGGAAGTTCATTGCCCATGACAAGCATCCGTCCTATCA
GTTCGGGCAATAACATTTCCTTGCAGACCCAGTCTCAAGTATATATTCCTGTGACTGCAAAAGGCCATAAGGAGTCCGTATATGCATTGG
CAATGAATGAGAGTGGATCCCTTCTTGTTTCTGGTGGTACTGAGAAGGTTGTGCGCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGA
AGCTAAAAGGTCATACAGATAATATTAGGGCTCTTCTGATAGACTCCACTGGCAGGTTCTGCATATCTGGATCCTCTGATTCCATGATTA
GACTATGGGATCTAGGTCAGCAGCGTTGCGTGCATTCTTATGCTGTGCATACGGATTCTGTATGGTCACTTGCTAGCACTCCTACGTTTA
GTCATGTTTATAGTGGTGGAAGAGACCTATCTTTATACTTGACAGATTTGGCAACAAGGGAGAGTGTATTGATGTGCACAAAGGAACACC
CCATTTTGCAGTTAGCATTGCATGATGATGGCATTTGGGTGGCCACAACTGATTCATCTGTACATAGGTGGGCTGCAGAAGTGCGTAATC
CCCAGAAAGTTTTCCAAAGAGGGGGCTCATTCTTGGCTGGAAACTTGTCCTTTTCCCGGGCAAGGGTTTCTCTAGAAGGATCTACACCTG
TTCCTGTTTATAAAGAACCATCTCTTAGCATTCCTGGAACTCCAGGAATAGTGCAGCATGAGATTTTGAACAACAGAAGACATGTCCTGA
CTAAGGATACTGCTGGAACAGTGAAGTTGTGGGAGATCACTAGAGGCACTGTGATTCACAACTATGGAGAGGTTTCATTTGAGAAGAAGA
AAGAAGAACTTTTTGAGATGGTGAGCATCCCTGCATGGTTCACTGTGGACACTAAGCTTGGAAACTTGTCTGTACATCTGGATACACCAC
AATGCTTTTCTGCTGAGATGTACTCTGCTGATCTCCACATTCCAGGGAAGCCTGAAGATGACAAGGTTAATTTGGCACGAGAAACCCTTA
AAGGGCTGTTGGCTCATTGGTTAGCCAAAAGAAAACAGAGATTTGGATCTCAAGCTTTGGCCAATGGGGAAGCCCCAGCTGGAAAGGATG
TACCTACAAGGAATCTGACCGCGTCAAAAATTGAAGTGGACGGTAGTGCTGACAATGATGCTGCAGTATATCCTCCCTTTGAATTTTCAG
CAGCATGCCCTCCATCAATTATTACTGAGGGTTCTCAAAGTGGTCCATGGAGGAAAAAGATTACCGACTTAGATGGAACAGAAGATGAAA
AGGACATGCCATGGTGGGTAGTGGATTGTGTGATGAACAATcGGTTGCCTCCCAGGGAAAATACCAAATGTAGCTTCTACTTACATCCAT
GcGAGGGTTCTACTGTTCAGATCCTTACCCAGGGAAAGCTGAGTGcGCCTCGCATATTAAGAATTCACAAAGTCGTCAACTATGTTATAG
AAAAGATGGTTCTTGATAAGCCACTGGATAGCCTAAACTCAGATGGAGCTGCTGGAGTGTCTGGTGGACAGGTGACACACCCAGCTAATG
GAGGAGATGGCATATTTCGGACTGGGCTGAAGCCTTGGCAAAAGCTTAAACCATCCATAGAGATATTGTGCAGTAACCAGGTCTTATCCC
CTGATATGAGCTTAGCGACTGTCCGTGCATATATATGGAAGAAACCTGAAGACCTTATCCTCAACTACCGGGTGTTGAcGAGCAAGGGAT
AGGATTCTGTCTGTCAGGTCCAGAGTAGCTGGAGGTGXATTGAGCTGCTCCTCAAAAATAATTGGAAGGTTTAGCATTCAACTGGCTGCT
TGCTGCTGTGTCATATGA(3')GTAGTTGCTTCCTTGTAGATCTGAGATCCAGGTGGTTGGATTAATTATGAAAATTTACACATTTGGAC
CATTTTTCTGTTTGCACGTCGGAAGGTGGTGATTATTGAGTTTTGGTTTTTGGTGCATTTAGAAGAAAATAGAAAGTTTGCATTTTCTAA
AGAAAGGATTTTTGGTTTTGAGGGGACATGAGGCTGAATGTTTCAAGAGAAAGAGCTCGTGATGATGTTGTCGGGAGCCTGTAGATTTAT
ATATAACTCTATATGCAAAGGCAGGGGTTTGGATTTCTTGATATAGTCTTTCAAGAACCACACTGTTGGGCAGGTGAATAATATCTCCAG
AACAAAAACTTACCTTTTCTGGTCAAAACTAATTTATATGTTTACTTTCTTTCTGGTATAATTTAATCTGTAAATCTTCTTTGTTATTAG
TGTTCCTCAATTTTAGTGGGGAAAGATTTGGTGATAGGCCATTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan