ESTScan Details for Unigene SGN-U584251

Score 
778
Direction 
Forward
Predicted Peptide Sequence 
XACLTAHPCHISASRLGQFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQMQSLRRSQMSGLLFGI
SQLALYGSEALILWYGAHLVNNGVSTFSKVIKVFVVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPDDPEGDPVESIRGD
IELRHVDFAYPSRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLKLKIGLVQQEPALFA
AAFLKISRMGKEGATEAEVIEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQE
ALKRLMRGQTTVLGGSPIINNSX
Predicted Coding Sequence 
XGGGCGTGTCTCACTGCTCATCCTTGCCACATTTCCGCTTCTCGTCTTGGCCAATTTGCCCAGCAACTCTCACTGAAAGGATTTGCCGGA
GACACGGCCAAGGCGCATGCAAAGACTAGCATGATTGCTGGAGAAGGAGTAAGCAATATTAGAACCGTAGCAGCCTTCAATGCCCAAGAG
AAGATTATCTCTTTGTTCTCCCAAGAGCTTAGAGTTCCACAAATGCAGAGTCTTCGACGAAGCCAAATGTCAGGTCTCTTATTTGGTATA
TCACAGCTTGCTCTTTATGGTTCTGAAGCTCTGATTCTTTGGTACGGTGCACACCTTGTTAACAACGGGGTCTCGACTTTCTCTAAGGTA
ATTAAGGTCTTTGTAGTCCTTGTGATCACGGCTAATTCAGTTGCTGAAACGGTCAGCCTAGCACCCGAGATTATTAGGGGTGGTGAAGCT
GTTGGTTCTGTATTTTCCATTCTTGATCGCTCTACCAGGGTCGATCCTGATGACCCTGAAGGCGATCCAGTTGAATCAATTAGAGGGGAT
ATTGAACTCCGTCATGTTGATTTTGCATACCCTTCACGACCGGATGTCTCTGTGTTCAAGGACCTCAATCTAAGGATTCGCGCTGGCCAA
AGCCAAGCTCTTGTTGGGGCAAGTGGATCGGGAAAGAGCTCTGTTATAGCCTTAATCGAAAGGTTCTATGATCCAACGGGTGGAAAAGTT
ATGATTGATGGGAAAGACATAAGGAGATTAAACTTGAAGTCTCTAAAGCTTAAGATTGGTTTGGTGCAACAAGAGCCAGCTCTTTTTGCA
GCTGCATTTTTGAAAATATCGCGTATGGGTAAAGAGGGTGCAACAGAAGCCGAAGTCATTGAAGCAGCTCGGGCAGCAAATGTACACACA
TTCGTTAGTGGTTTGCCTGAAGGTTACAAAACCCCTGTTGGTGAGAGAGGTGTTCAACTCTCAGGAGGACAAAAACAAAGGATTGCAATT
GCAAGGGCCGTTCTTAAAGATCCATCGATTCTACTACTTGATGAGGCTACAAGTGCACTGGATGCTGAATCCGAATGTGTGTTACAAGAA
GCACTCAAAAGGTTGATGAGAGGTCAAACCACCGTTTTGGGTGGCTCACCGATTATCAACAATTCCAAX
Edits in Original Sequence 
(5')XGGGCGTGTCTCACTGCTCATCCTTGCCACATTTCCGCTTCTCGTCTTGGCCAATTTcGCCCAGCAACTCTCACTGAAAGGATTTG
CCGGAGACACGGCCAAGGCGCATGCAAAGACTAGCATGATTGCTGGAGAAGGAGTAAGCAATATTAGAACCGTAGCAGCCTTCAATGCCC
AAGAGAAGATTATCTCTTTGTTCTCCCAAGAGCTTAGAGTTCCACAAATGCAGAGTCTTCGACGAAGCCAAATGTCAGGTCTCTTATTTG
GTATATCACAGCTTGCTCTTTATGGTTCTGAAGCTCTGATTCTTTGGTACGGTGCACACCTTGTTAACAACGGGGTCTCGACTTTCTCTA
AGGTAATTAAGGTCTTTGTAGTCCTTGTGATCACGGCTAATTCAGTTGCTGAAACGGTCAGCCTAGCACCCGAGATTATTAGGGGTGGTG
AAGCTGTTGGTTCTGTATTTTCCATTCTTGATCGCTCTACCAGGGTCGATCCTGATGACCCTGAAGGCGATCCAGTTGAATCAATTAGAG
GGGATATTGAACTCCGTCATGTTGATTTTGCATACCCTTCACGACCGGATGTCTCTGTGTTCAAGGACCTCAATCTAAGGATTCGCGCTG
GCCAAAGCCAAGCTCTTGTTGGGGCAAGTGGATCGGGAAAGAGCTCTGTTATAGCCTTAATCGAAAGGTTCTATGATCCAACGGGTGGAA
AAGTTATGATTGATGGGAAAGACATAAGGAGATTAAACTTGAAGTCTCTAAAGCTTAAGATTGGTTTGGTGCAACAAGAGCCAGCTCTTT
TTGCAGCTaGCATTTTTGAAAATATCGCGTATGGGTAAAGAGGGTGCAACAGAAGCCGAAGTCATTGAAGCAGCTCGGGCAGCAAATGTA
CACACATTCGTTAGTGGTTTGCCTGAAGGTTACAAAACCCCTGTTGGTGAGAGAGGTGTTCAACTCTCAGGAGGACAAAAACAAAGGATT
GCAATTGCAAGGGCCGTTCTTAAAGATCCATCGATTCTACTACTTGATGAGGCTACAAGTGCACTGGATGCTGAATCCGAATGTGTGTTA
CAAGAAGCACTCAAAAGGTTGATGAGAGGTCAAACCACCGTTTTGGGTGGCTCACCGATTATCAACAATTCCAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan