ESTScan Details for Unigene SGN-U584377

Score 
206
Direction 
Forward
Predicted Peptide Sequence 
RKEKNREDDREGGLVVGTVDSNDNDIGAETTSLKRVNRNAYADYDVYGNSEGLRVLCGDSSNAPITYPAGVEADLVVIASLDVPLHWVQT
LEQEDGAKVVRVKNLNNPYCINPNWRFKLTLNKLYAWSLVDYDRVVMLDADNLFLQKTDELFQCGQFCAVFINPCIFHTGLFVLQPSKMV
FNDMIHEIEIGRENQDGADQGFIGGHFPDLLDRPMFHPTLNGTQLQGSYRLPLGYQMDASYYYLKLHWSVPCGPNSVITFPGAPWLKPWY
WWSWPVLPLGIQWHEQRRLTVGYGAEMIAXTDPIYILPRNNCSDTPSTPNFIK
Predicted Coding Sequence 
AGGAAAGAGAAAAACAGAGAAGATGATAGGGAGGGCGGGCTTGTTGTTGGTACTGTTGATAGCAACGATAACGACATTGGAGCTGAAACG
ACGTCGTTAAAAAGGGTAAACAGAAATGCGTATGCXGACTATGATGTATATGGGAACTCCGAGGGACTACGAGTTTTATGTGGCGACTCG
AGTAATGCTCCGATCACTTACCCGGCAGGAGTTGAAGCCGATCTCGTTGTTATTGCTTCACTTGACGTTCCTCTTCACTGGGTTCAAACT
CTAGAACAGGAAGATGGTGCAAAGGTAGTGAGAGTTAAAAATCTGAACAATCCGTATTGTATCAACCCTAATTGGAGATTCAAGCTCACA
CTGAACAAACTTTATGCGTGGAGCCTCGTGGATTATGACAGGGTTGTCATGCTTGATGCAGATAACCTTTTCCTCCAGAAAACTGATGAA
CTGTTCCAATGTGGCCAGTTTTGTGCTGTCTTCATCAATCCCTGCATCTTCCACACTGGTCTCTTCGTCTTACAGCCATCAAAAATGGTG
TTCAATGACATGATTCATGAGATAGAGATTGGGAGGGAAAATCAAGACGGTGCAGACCAAGGTTTTATTGGAGGTCACTTCCCTGATTTA
CTTGATCGGCCGATGTTCCACCCTACTCTTAATGGTACGCAGCTCCAGGGAAGTTACAGGCTTCCTCTAGGATATCAAATGGACGCGTCT
TATTATTATCTCAAACTCCACTGGTCGGTACCTTGTGGACCTAATAGTGTCATTACATTTCCTGGTGCTCCATGGTTAAAACCATGGTAT
TGGTGGTCATGGCCTGTCTTACCTTTGGGCATCCAGTGGCATGAACAGCGACGTCTAACTGTTGGGTACGGTGCTGAGATGATAGCAGXT
ACTGATCCAATCTATATTCTACCTAGGAATAATTGCAGTGACACGCCTAGCACGCCAAATTTTATCAAA
Edits in Original Sequence 
GGCGATTGGCGGCCAATCGGCCGAATTGAACTTTATTCAATACTCTTCTATCCATCGGCTCCGAGATCTTCTTTTCCAACTTTATTCAAT
ACACTTGCCGGAGGCCATTTTCACCGGAATCTTTTTTTTCCCGGTGAAAGTTTGAACCCACACTGTTATTTCTAGGTAGAAGTAGTAGAT
AATATCATGTGAAAAACATCACAAGTTTTTGAAGACTTGTGATTAATTACTTGAGATTTTTTTATTTGG
(5')AGGAAAGAGAAAAACAG
AGAAGATGATAGGGAGGGCGGGCTTGTTGTTGGTACTGTTGATAGCAACGATAACGACtATTGGAGCTGAAACGACGTCGTTAAAAAGGG
TAAACAGAAATGCGTATGCXGACTATGATGTATATGGGAACTCCGAGGGACTACGAGTTTTATGTGGCGACTCGAGTAATGCTCCGATCA
CTTACCCGGCtAGGAGTTGAAGCCGATCTCGTTGTTATTGCTTCACTTGACGTTCCTCTTCACTGGGTTCAAACTCTAGAACAGGAAGAT
GGTGCAAAGGTAGTGAGAGTTAAAAATCTGAACAATCCGTATTGTATCAACCCTAATTGGAGATTCAAGCTCACACTGAACAAACTTTAT
GCGTGGAGCCTCGTGGATTATGACAGGGTTGTCATGCTTGATGCAGATAACCTTTTCCTCCAGAAAACTGATGAACTGTTCCAATGTGGC
CAGTTTTGTGCTGTCTTCATCAATCCCTGCATCTTCCACACTGGTCTCTTCGTCTTACAGCCATCAAAAATGGTGTTCAATGACATGATT
CATGAGATAGAGATTGGGAGGGAAAATCAAGACGGTGCAGACCAAGGTTTTATTGGAGGTCACTTCCCTGATTTACTTGATCGGCCGATG
TTCCACCCTACTCTTAATGGTACGCAGCTCCAGGGAAGTTACAGGCTTCCTCTAGGATATCAAATGGACGCGTCTTATTATTATCTCAAA
CTCCACTGGTCGGTACCTTGTGGACCTAATAGTGTCATTACATTTCCTGGTGCTCCATGGTTAAAACCATGGTATTGGTGGTCATGGCCT
GTCTTACCTTTGGGCATCCAGTGGCATGAACAGCGACGTCTAACTGTTGGGTACGGTGCTGAGATGATAGCAGXTACTGATCCAATCTAT
ATTCTACCTAGGAATAATTGCAGTGACACGCCTAGCACGCCAAATTTTATCAAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan