ESTScan Details for Unigene SGN-U584417

Score 
405
Direction 
Forward
Predicted Peptide Sequence 
XRAIGGQSAELVREHSQEEDRDKMGXPLKMEKDVGENINGEFEAVAVISGNDSVQGSLQFIQQSNGVTHVRGRIIGLAPGLHAFHIHALG
DTTNGCNSTGPHFNPLKKDHGAPMDEVRHAGDLGNIVAGPNGVAEISISDMQIPLSGVHSILGRAVVVHADPDDLGRGGHELSKTTGNAG
ARVGCGVIGLQSSV*
Predicted Coding Sequence 
XXTAGGGCGATTGGCGGCCAATCGGCCGAATTGGTGAGAGAACACAGCCAGGAGGAGGATAGAGACAAAATGGGTGAXCCCTTAAAAATG
GAGAAAGATGTAGGGGAAAATATTAATGGGGAATTTGAAGCAGTAGCTGTAATCTCCGGGAACGATAGTGTGCAAGGATCCTTACAATTC
ATCCAGCAATCCAATGGTGTTACCCATGTGAGAGGAAGAATAATTGGTCTAGCTCCAGGTCTTCACGCTTTCCATATCCATGCCTTGGGT
GATACCACTAACGGCTGCAATTCCACTGGACCTCATTTTAATCCACTTAAGAAAGATCATGGAGCTCCCATGGATGAAGTACGTCATGCG
GGTGATTTAGGCAACATTGTTGCTGGTCCTAATGGGGTGGCAGAGATATCAATTTCAGATATGCAGATTCCTCTTAGTGGAGTACACTCC
ATCTTGGGGAGAGCAGTAGTTGTGCATGCTGATCCTGATGATCTGGGAAGAGGTGGACATGAACTTAGTAAGACAACTGGAAACGCAGGT
GCAAGAGTTGGCTGTGGCGTTATTGGGCTTCAATCATCTGTCTAA
Edits in Original Sequence 
(5')XXTAGGGCGATTGGCGGCCAATCGGCCGAATTGGTGAGAGAACACAGCCAGGAGGAGGATAGAGACAAAATGGGTGAXCCCTTAAA
AATGGAGAAAGATGTAGGGGAAAATATTAATGGGGAATTTGaAAGCAGTAGCTGTAATCTCCGGGAACGATAGTGTGCAAGGATCCTTAC
AATTCATCCAGCAATCCAATGGTGTTACCCATGTGAGAGGAAGAATAATTGGTCTAGCTCCAGGTCTTCACGCTTTCCATATCCATGCCT
TGGGTGATACCACTAACGGCTGCAATTCCACTGGACCTCATTTTAATCCACTTAAGAAAGATCATGGAGCTCCCATGGATGAAGTACGTC
ATGCGGGTGATTTAGGCAACATTGTTGCTGGTCCTAATGGGGTGGCAGAGATATCAATTTCAGATATGCAGATTCCTCTTAGTGGAGTAC
ACTCCATCTTGGGGAGAGCAGTAGTTGTGCATGCTGATCCTGATGATCTGGGAAGAGGTGGACATGAACTTAGTAAGACAACTGGAAACG
CAGGTGCAAGAGTTGGCTGTGGCGTTATTGGGCTTCAATCATCTGTCTAA(3')TGTTTGTGTTACTCAGTTAATCATGTTAAACTAGCA
ATACTCTCAACTTTCCATATATCTCAAAGAGCTGATTAATAAAATAGTAGTGATTTAACACTCAGCTCAAGTGTTTGAACCTTAGTTACA
TTTTGCTAGTGAAAATAATGAGCGTCTCTTTCTCGATTGTGTAGACAATTTCGATTACGTTGGGTGTGATGGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan