ESTScan Details for Unigene SGN-U584673

Score 
249
Direction 
Forward
Predicted Peptide Sequence 
XWKLNVADIEATLSRVCQMVLQDNNVKKEELRARAKGLKTLGKIFQKVKPVNEVETTENGVHKLDGNEPSYDSRSSTASVPSQNKEEVPY
TVFASQSPYVEAPQFTGGQSSYNFPMPTAPPGGRDTGRQTNGGRRKNLCSL*
Predicted Coding Sequence 
XGCTGGAAGCTTAATGTAGCAGATATTGAAGCCACTCTTTCTCGTGTTTGTCAAATGGTTCTACAAGACAACAACGTAAAGAAAGAAGAG
CTTCGTGCCCGCGCAAAGGGGTTAAAGACTCTCGGCAAAATTTTTCAGAAGGTTAAGCCAGTCAATGAAGTCGAAACTACAGAAAATGGC
GTCCATAAGCTGGACGGAAATGAACCAAGCTATGACTCTCGTTCTTCAACTGCATCAGTACCATCTCAAAACAAAGAAGAGGTGCCTTAT
ACAGTATTTGCATCACAGAGCCCATACGTGGAGGCTCCACAGTTTACCGGTGGTCAATCCAGCTATAACTTCCCCATGCCGACTGCACCA
CCAGGTGGCAGAGACACAGGTAGACAGACAAATGGTGGACGCCGCAAGAATTTGTGTAGCTTGTGA
Edits in Original Sequence 
(5')XGCTGGAAGCTTAATGTAGCAGATATTGAAGCCACTCTTTCTCGTGTTTGTCAAATGGTTCTACAAGACAACAACGTAAAGAAAGA
AGAGCTTCGTGCCCGCGCAAAGGGGTTAAAGACTCTCGGCAAAATTTTTCAGAAGGTTAAGCCAGTCAATGAAGTCGAAACTACAGAAAA
TGGCGTCCATAAGCTGGACGGAAATGAACCAAGCTATGACTCTCGTTCTTCAACTGCATCAGTACCATCTCAAAACAAAGAAGAGGTGCC
TTATACAGTATTTGCATCACAGAGCCCATACGTGGAGGCTCCACAGTTTACCGGTGGTCAATCCAGCTATAACTTCCCCATGCCGACTGC
ACCACCAGGTGcGCAGAGACACAGGTAGACAGACAAATGGTGGACGCCGCAAGAATTTGTGTAGCTTGTGA(3')ATTTGTAGTGAGTTT
GAGTTTCTTATGTATCCCTAGTGTGCTATATTTAAAGCATAATTCTTGCTTAGCAGAGAAAAGCTTCTGTCATATTGCTTTTTATGAAGG
ACTGCTTTGTAATTAATATAGTTATTAGAGTGTAAGTTGTGTGGCCTGTGAATGCAAAATATTGTATATTGCATTGGTCTATTTATATTG
TATGTTGTAATAACCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan