ESTScan Details for Unigene SGN-U584726

Score 
1321
Direction 
Forward
Predicted Peptide Sequence 
MVSSTILIQQPTNFFHQPELHHQLWRGLQHGCVASLQKQPILVCNSNKRNRPLRVSSSANGAVTSSTLEAYDSSPSPSAFPLFTPPSQPQ
DTPASQLELADPDFYKIGYVRSFRAYGIEFREGPDGYGVFASKDVEPLRRARVIMEIPLELMLTISKKLPWMFFPDIIPVGHPVFDIINS
TNPETDSDLRLACLLLYAFDCKDNFWQLYGDFLPSADECTSFLLATEEDLLELQDEKLASTMREQQNRALEFWEKNWHSAVPLKIKRLAQ
DPERFIWAMSIAQSRCISMQTRIGSLVQEANMLVPYADMMNHSFQPNCFFHWRFKDRMLEVMINAGQKIRKGDEMTVNYMAGQKNDLFMQ
RYGFSSPVNPWDVIHFTGDAKIHLDTFLSVFNISGLPGEYYHNTGKLSNDGDRFVDGAIIAAARTLPTWSDGDLPPIPSLERKAVKELQE
ECHQMLAEFPTTSDEDQKILDSMPECRRTFEAAIKYRLXSEITDREGYTGLGHLPRQDSVLNRITAGVEAIFTRNHVAIEDGRQDYGSIS
AMQKALSITIAFATF*
Predicted Coding Sequence 
ATGGTTTCTTCCACCATTCTAATTCAGCAACCGACGAACTTCTTCCACCAGCCAGAGCTTCACCATCAGCTATGGAGAGGTCTGCAGCAT
GGATGTGTTGCATCATTGCAGAAACAACCTATTTTGGTATGTAATAGTAACAAGAGAAACAGACCTTTGAGAGTTTCTTCAAGTGCTAAT
GGTGCTGTTACTTCTTCCACTTTGGAGGCCTATGATTCTTCTCCGTCTCCTTCTGCATTTCCTCTTTTTACACCCCCTTCTCAACCCCAA
GATACTCCCGCTTCTCAGTTGGAACTGGCAGATCCTGATTTCTACAAAATAGGATATGTTAGAAGTTTTCGAGCCTACGGGATTGAATTC
AGGGAGGGACCAGATGGGTATGGAGTGTTTGCTTCCAAAGACGTGGAACCTCTCCGTCGAGCTAGGGTAATAATGGAAATTCCTTTAGAA
CTTATGTTAACCATAAGCAAAAAGCTTCCTTGGATGTTTTTTCCAGATATTATACCTGTAGGACATCCAGTATTCGACATTATCAATTCA
ACCAATCCCGAGACAGATTCGGACTTGAGGTTGGCGTGCCTTCTTTTATATGCTTTTGATTGCAAGGACAACTTTTGGCAGCTATACGGA
GACTTCTTGCCTAGTGCTGATGAATGCACTAGCTTTCTTCTAGCTACCGAGGAGGATCTTTTGGAGTTGCAAGACGAGAAGCTTGCTTCT
ACCATGAGAGAACAGCAAAATCGAGCACTTGAGTTTTGGGAGAAAAACTGGCATTCTGCAGTACCTCTCAAAATTAAGCGTCTTGCTCAG
GATCCTGAGAGATTTATTTGGGCAATGAGTATAGCACAATCTCGATGCATCAGCATGCAAACAAGAATTGGTTCACTGGTTCAAGAAGCA
AATATGTTGGTACCTTATGCTGACATGATGAATCATTCTTTTCAGCCAAATTGCTTTTTCCATTGGCGCTTCAAGGACCGCATGCTGGAG
GTGATGATAAATGCAGGACAAAAAATTAGAAAAGGAGATGAGATGACTGTTAATTACATGGCTGGACAGAAGAATGACTTATTTATGCAG
AGATATGGTTTCTCATCGCCTGTGAATCCTTGGGATGTCATTCATTTCACCGGAGATGCCAAAATTCATCTAGACACCTTTTTATCGGTC
TTTAACATATCTGGCCTCCCTGGAGAATATTACCACAACACAGGTAAGCTATCAAATGATGGAGACAGATTCGTCGATGGAGCAATAATA
GCAGCCGCAAGAACGTTGCCCACTTGGTCAGATGGAGATCTCCCTCCAATTCCAAGTCTAGAGAGGAAAGCAGTGAAGGAGCTGCAAGAA
GAATGCCACCAGATGCTTGCAGAATTTCCCACAACTTCTGACGAAGACCAGAAAATCCTAGATTCGATGCCTGAATGCAGGAGAACATTC
GAAGCAGCAATAAAGTATAGATTAXCATCGGAAATTACTGATAGAGAAGGTTATACAGGCCTTGGACATTTACCAAGACAGGATTCTGTT
CTAAACAGAATAACAGCAGGAGTTGAAGCAATCTTTACCAGAAATCATGTAGCCATAGAAGACGGGCGTCAAGATTATGGTTCCATTTCA
GCTATGCAGAAAGCTTTATCTATCACAATAGCTTTTGCAACATTTTGA
Edits in Original Sequence 
GCCCCTGGGCACTCTCTCACTGACAGTAGAGTGGATAACGTTTCAAGAACCCAAATTCCATCGATGTATGAATCTTCTTTACTGAAATTC
CACTAAATTTTTAGCTCACTCTCAAGA
(5')ATGGTTTCTTCCACCATTCTAATTCAGCAACCGACGAACTTCTTCCACCAGCCAGAGCT
TCACCATCAGCTATGGAGAGGTCTGCAGCATGGATGTGTTGCATCATTGCAGAAACAACCTATTTTGGTATGTAATAGTAACAAGAGAAA
CAGACCTTTGAGAGTTTCTTCAAGTGCTAATGGTGCTGTTACTTCTTCCACTTTGGAGGCCTATGATTCTTCTCCGTCTCCTTCTGCATT
TCCTCTTTTTACACCCCCTTCTCAACCCCAAGATACTCCCGCTTCTCAGTTGGAACTGGCAGATCCTGATTTCTACAAAATAGGATATGT
TAGAAGTTTTCGAGCCTACGGGATTGAATTCAGGGAGGGACCAGATGGGTATGGAGTGTTTGCTTCCAAAGACGTGGAACCTCTCCGTCG
AGCTAGGGTAATAATGGAAATTCCTTTAGAACTTATGTTAACCATAAGCAAAAAGCTTCCTTGGATGTTTTTTCCAGATATTATACCTGT
AGGACATCCAGTATTCGACATTATCAATTCAACCAATCCCGAGACAGATTCGGACTTGAGGTTGGCGTGCCTTCTTTTATATGCTTTTGA
TTGCAAGGACAACTTTTGGCAGCTATACGGAGACTTCTTGCCTAGTGCTGATGAATGCACTAGCTTTCTTCTAGCTACCGAGGAGGATCT
TTTGGAGTTGCAAGACGAGAAGCTTGCTTCTACCATGAGAGAACAGCAAAATCGAGCACTTGAGTTTTGGGAGAAAAACTGGCATTCTGC
AGTACCTCTCAAAATTAAGCGTCTTGCTCAGGATCCTGAGAGATTTATTTGGGCAATGAGTATAGCACAATCTCGATGCATCAGCATGCA
AACAAGAATTGGTTCACTGGTTCAAGAAGCAAATATGTTGGTACCTTATGCTGACATGATGAATCATTCTTTTCAGCCAAATTGCTTTTT
CCATTGGCGCTTCAAGGACCGCATGCTGGAGGTGATGATAAATGCAGGACAAAAAATTAGAAAAGGAGATGAGATGACTGTTAATTACAT
GGCTGGACAGAAGAATGACTTATTTATGCAGAGATATGGTTTCTCATCGCCTGTGAATCCTTGGGATGTCATTCATTTCACCGGAGATGC
CAAAATTCATCTAGACACCTTTTTATCGGTCTTTAACATATCTGGCCTCCCTGGAGAATATTACCACAACACAGGTAAGCTATCAAATGA
TGGAGACAGATTCGTCGATGGAGCAATAATAGCAGCCGCAAGAACGTTGCCCACTTGGTCAGATGGAGATCTCCCTCCAATTCCAAGTCT
AGAGAGGAAAGCAGTGAAGGAGCTGCAAGAAGAATGCCACCAGATGCTTGCAGAATTTCCCACAACTTCTGACGAAGACCAGAAAATCCT
AGATTCGATGCCTGAATGCAGGAGAACATTCGAAGCAGCAATAAAGTATAGATTAXCATCGGAAATTACTGATAGAGAAGGTTATACAGG
CCTTGGACATTTACCAAGACAGGATTCTGTTCTAAACAtGAATAACAGCAGGAGTTGAAGCAATCTTTACCAGAAATCATGTAGCCATAG
AAGACGGGCGTCAAGATTATGGTTCCATTTCAGCTATGCAGAAAGCTTTATCTATCACAATAGCTTTTGCAACATTTTGA(3')GGGCTT
TTGTTGGGGGTGGGTGTAGGAAGTAGCTAGTAATGGTGTATAGGTGGAAAATGACTTATACCATTAGTTTTGGAAAGATATGAAGTGAAG
AAAAATGAGAAGTTCTCTATAGAAATCATGATGAAAATGAAGGATAGCTTTGGTGGATATGTTTGATAACAAGTAGAAAGGCTCTTTTGC
ATGAATGAAATATATGAATTCTCTTTAACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan