ESTScan Details for Unigene SGN-U584776

Score 
420
Direction 
Forward
Predicted Peptide Sequence 
MGSFVSTLLGGGEAQAATEVSGSPSEPSRVIAFHSSNRWQLHFNSSKQLNKLIVVDFAAAGAGPCKFMEPAINAMASKYTDVDFVKIDVD
ELSDVAKEFGVQAXANIFAAETRQGSRESCWGKKDELEKKILKHREAPKYAAYSSDILXDNIGAEFHI*
Predicted Coding Sequence 
ATGGGTTCCTTTGTTTCAACCTTACTCGGCGGAGGTGAAGCGCAGGCAGCAACGGAAGTGTCAGGATCGCCGTCAGAGCCGTCGCGTGTG
ATTGCTTTTCATTCATCCAATCGGTGGCAACTTCACTTCAACTCCTCCAAGCAATTGAATAAACTGATAGTTGTGGATTTTGCGGCTGCT
GGTGCXGGGCCTTGCAAGTTCATGGAGCCGGCTATTAACGCCATGGCTTCCAAGTATACCGATGTTGACTTTGTCAAAATTGACGTCGAT
GAGCTCTCGGACGTAGCGAAAGAGTTCGGAGTTCAAGCTXATGCCAACATTTTTGCTGCTGAAACAAGGCAAGGAAGTAGAGAGAGTTGT
TGGGGTAAAAAAGATGAGCTCGAGAAAAAGATTCTCAAGCACAGGGAAGCCCCTAAATATGCTGCTTATTCTTCTGACATCCTCTXTGAT
AATATTGGAGCTGAATTTCATATCTAA
Edits in Original Sequence 
AATAATTTCCTTCTCTATTTTGACTACTTTTGCGTAAGAAGTGAGGAGTCGA(5')ATGGGTTCCTTTGTTTCAACCTTACTCGGCGGAG
GTGAAGCGCAGGCAGCAACGGAAGTGTCAGGATCGCCGTCAGAGCCGTCGCGTGTGATTGCTTTTCATTCATCCAATCGGTGGCAACTTC
ACTTCAACTCCTCCAAGCAATTGAATAAACTGATAGTTGTGGATTTTGCGGCTGCaTGGTGCXGGGCCTTGCAAGTTCATGGAGCCGGCT
ATTAACGCCATGGCTTCCAAGTATACCGATGTTGACTTTGTCAAAATTGACGTCGATGAGCTCTCGGACGTAGCGAAAGAGTTCGGAGTT
CAAGCTXATGCCAACATTTTTGCTGCTGAAACAAGGCAAGGAAGTAGAGAGAGTTGTTGGGGTAAAAAAGATGAGCTCGAGAAAAAGATT
CTCAAGCACAGGGAAGCCCCTAAATATGCTGCTTAgTTCTTCTGACATCCTCTXTGATAATATTGGAGCTGAATTTCATATCTAA(3')T
AAGTTTAAACTGCCTTATTCTGATGTGATTTGACTATGGTTCTGATGTCTTTCCCCCATTTTTTCCCTGCTTAAGTTTCTAATTGTGTTA
TTGTACTCTTTGAAACTTTGAATTCATGATTTGCCTGTTACTGCTTCAGAATATGAGAAAATGGGAGTTCAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan