Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U584916

Score 
349
Direction 
Forward
Predicted Peptide Sequence 
XSTSNLQLYQIVFQRAHSSWVLVCDQLLYRRCDIEXHFVLKIFSPALGLPGGASAKDAIIKAKWRXKNMLKLSHVLAFLLLASLFQSLMA
RDLISDGIEVVKFPVEDDGEFVFCPGKLSWPELVGKSAGYAKEVIQKENPIVHDVRLLFPGMIRPLNYVCGRVFLVVNFKRIVRVTPSMG
*
Predicted Coding Sequence 
XGGAGTACGAGTAACCTGCAGTTGTACCAGATTGTCTTCCAAAGAGCCCATTCAAGTTGGGTCCTTGTTTGTGACCAGCTCCTTTATCGA
CGGTGTGACATTGAGCAXCACTTTGTCTTGAAGATCTTTTCTCCGGCTTTAGGGTTACCTGGTGGTGCTTCCGCGAAAGATGCCATAATA
AAAGCAAAATGGAGGGAXAAGAATATGCTCAAGTTATCTCATGTGCTTGCTTTCTTGCTTCTTGCATCACTTTTTCAATCACTGATGGCA
AGAGATTTGATCAGTGATGGCATAGAAGTAGTGAAATTTCCAGTGGAAGATGATGGAGAATTTGTATTTTGCCCAGGTAAGCTATCATGG
CCTGAACTTGTTGGGAAATCAGCAGGATATGCAAAAGAAGTAATTCAAAAGGAAAATCCCATAGTTCATGATGTTAGGCTTCTATTTCCT
GGTATGATTAGGCCACTTAATTATGTTTGTGGCAGAGTTTTTCTGGTTGTTAACTTTAAACGCATTGTTCGAGTTACTCCCTCTATGGGT
TAG
Edits in Original Sequence 
(5')XGGAGTACGAGTAACCTGCAGTTGTACCAGATTGTCTTCCAAAGAGCCCATTCAAGTTGGGTCCTTGTTTGTGACCAGCTCCTTTA
TCGACGGTGTGACATTGAGCAXCACTTTGTCTTGAAGATCTTTTCTCCGGCTTTAGGGTTACCTGGTGGTGCTTCCGCGAAAGATGCCAT
AATAAAAGCAAAATGGAGGGAXAAGAATATGCTCAAGTTATCTCATGTGCTTGCTTTCTTGCTTCTTGCATCACTTTTTCAATCACTGAT
GGCAAGAGATTTGATCAGTGATGGCATAGAAGTAGTGAAATTTCCAGTGGAAGATGATGGAGAATTTGTATTTTGCCCAGGTAAGCTATC
ATGGCCTGAACTTGTTGGGAAATCAGCAGGATATGCAAAAGAAGTAATTCAAAAGGAAAATCCCATAGTTCATGATGTTAGGCTTCTATT
TCCTGGTATGATTAGGCCACTTAATTATGTTTGTGGCAGAGTTTTTCTGGTTGTTAACTTTAAACGCATTGTTCGAGTTACTCCCTCTAT
GGGTTAG(3')TAACATTATTCTCATTATTATGTTATTATGAAAATTAAATAAAGTGGAGATATTAAATATAATGTCTTCATGTACTCTA
CTATTTCAGCATAAATAAAACTAATGTGTTATTTTCTTTTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan