ESTScan Details for Unigene SGN-U584953

Score 
369
Direction 
Forward
Predicted Peptide Sequence 
MGNQGQDMSMAIYKNSNFTGGCLEIRLFYVRITPCAVETVPDHLILRHLRREMGVTLEINSSRIPANDTGIITLRRDRVDKESSEVTFVS
TDSVRVSGPVEFEVHENENELILCGSLERVETTWANGNVLENDSRSGWSMDCYTAASFGNGGSAFFQPKFGVSLPSIEVYIAGCCSGVPV
ILSKTIQVSPRRKLPRQGMLDAIPEDEEVAKEQGSSNGFGRQIKPLQTTEDMDDYEVEQKAGYGFYSDDMYPGEDGQLTWFNAGVRVGVG
KASACAVGVGIGVGLLMLHIRQPLGICGGGFSRLLTFSHSEMDFLTGFNYWKKDFMVIKVGLILVAAGKXETPSAAAEEW
Predicted Coding Sequence 
ATGGGTAATCAAGGTCAGGATATGTCAATGGCAATCTACAAAAACTCGAATTTCACCGGAGGTTGTTTGGAAATCCGATTGTTTTATGTA
CGTATCACGCCATGCGCGGTTGAAACCGTACCGGACCACCTCATACTCCGCCACCTCCGCCGTGAGATGGGGGTAACGTTAGAGATCAAC
AGTTCGCGTATTCCGGCTAATGATACAGGCATCATAACCCTCCGACGTGATCGGGTTGATAAGGAATCGTCGGAGGTAACGTTTGTGAGC
ACGGACAGCGTTAGGGTTTCAGGGCCGGTGGAATTTGAGGTACATGAGAATGAAAATGAGTTAATACTTTGTGGGTCGTTGGAGAGAGTA
GAGACAACGTGGGCTAATGGTAATGTTTTAGAGAATGATTCGAGGAGTGGATGGAGCATGGATTGTTACACAGCAGCATCATTTGGGAAT
GGTGGATCAGCTTTTTTTCAGCCTAAATTTGGGGTTTCTTTACCATCAATCGAGGTATACATAGCGGGTTGCTGTTCAGGTGTCCCTGTG
ATTCTATCAAAGACAATTCAGGTCAGCCCGAGAAGGAAGTTACCTAGGCAGGGTATGTTGGATGCAATTCCAGAGGATGAGGAGGTTGCG
AAGGAGCAGGGGAGCTCGAATGGATTCGGACGACAAATAAAACCATTGCAGACCACAGAGGATATGGACGATTATGAGGTGGAGCAGAAG
GCTGGATATGGTTTCTATTCAGACGACATGTACCCTGGTGAAGATGGTCAGCTCACCTGGTTCAACGCAGGAGTGAGGGTTGGTGTTGGG
AAGGCCTCGGCATGTGCXGTTGGTGTTGGAATTGGGGTGGGACTACTTATGCTTCATATCAGGCAACCACTAGGAATCTGCGGAGGAGGT
TTTTCTAGGCTTCTAACTTTCAGTCATAGTGAAATGGACTTCTTGACTGGATTCAACTACTGGAAAAAGGACTTTATGGTCATTAAAGTA
GGTCTCATCTTAGTGGCAGCAGGCAAAGXGGAGACCCCTAGTGCTGCAGCTGAAGAGTGG
Edits in Original Sequence 
AGCTCTTAAGTTTTTCCGTTGACCCCTCGTAAAATAATGGTAGCTTTTAATCCTTTCTCTCGCCATGTTCACACATAACGAAACATCTAC
ACTATTTCTCAACCGATCCATGTGTGATTTTTATGGATCCTTAACCTTGAATTTTGTTCAATTCTCCTTGTTAATCAATGATCAATTTCC
TTCAATTTTTGTAGATTGAAGAAAAAATTGGGATTA
(5')ATGGGTAATCAAGGTCAGGATATGTCAATGGCAATCTACAAAAACTCGAA
TTTCACCGGAGGTTGTTTGGAAATCCGATTGTTTTATGTACGTATCACGCCATGCGCGGTTGAAACCGTACCGGACCACCTCATACTCCG
CCACCTCCGCCGTGAGATGGGGGTAACGTTAGAGATCAACAGTTCGCGTATTCCGGCTAATGATACAGGCATCATAACCCTCCGACGTGA
TCGGGTTGATAAGGAATCGTCGGAGGTAACGTTTGTGAGCACGGACAGCGTTAGGGTTTCAGGGCCGGTGGAATTTGAGGTACATGAGAA
TGAAAATGAGTTAATACTTTGTGGGTCGTTGGAGAGAGTAGAGACAACGTGGGCTAATGGTAATGTTTTAGAGAATGATTCGAGGAGTGG
ATGGAGCATGGATTGTTACACAGCAGCATCATTTGGGAATGGTGGATCAGCTTTTTTTCAGCCTAAATTTGGGGTTTCTTTACCATCAAT
CGAGGTATACATAGCGGGTTGCTGTTCAGGTGTCCCTGTGATTCTATCAAAGACAATTCAGGTCAGCCCGAGAAGGAAGTTACCTAGGCA
GGGTATGTTGGATGCAATTCCAGAGGATGAGGAGGTTGCGAAGGAGCAGGGGAGCTCGAATGGATTCGGACGACAAATAAAACCATTGCA
GACCACAGAGGATATGGACGATTATGAGGTGGAGCAGAAGGCTGGATATGGTTTCTATTCAGACGACATGTACCCTGGTGAAGATGGTCA
GCTCACCTGGTTCAACGCAGGAGTGAGGGTTGGTGTTGGGAtAGGCCTCGGCATGTGCXGTTGGTGTTGGAATTGGGGTGGGACTACTTA
TGCgTTCATATCAGGCAACCACTAGGAATCTGCGGAGGAGGTTTTTCTAGGCTTCTAACTTTCAGTCATAGTGAAATGGACTTCTTGACT
GGATTCtAACTACTGGAAAAAGGACTTTATGGTCATTAAAGTAGGTCTCATCTTAGTGGCAGCAGGCAAAGXGGAGACCCCTAGTGCTGC
AGCTGAAGAGTGG(3')TTACGTATTAGGTGGTGTGAGGCTGTAACGCAATTCAGTATCCTTGTACAGAAGCTGCAGACGACGTTCATCC
AAGGATCATCTGTGTTGAGATTATACAAAAGCCCCCAGGCTGAAAATCGGTGTTAGTGTGTTCATATGCTGTATTTAAACTGAATATCTC
GTATACATGTCCTTTTTTTCTTCTTTTTTTCTTTCGGGTTGGTTTAAACTCATCAGCTTTGCTGTTGGTGTGTGCTGAAGTTTGTTATTA
AGGTTAGCTTTAGAGAGTTGACAATGCGGCCGACAATTTTGGTAGTTGCAATAGGTGCTTCGGCGTAACAAATTTAGTTTGTAAAAGTAC
TCGGCAAATTGTTTCTATAACAGCTTGTTTTGAAAAGTTGTAGCATATTGTTGTACAAATGTATCGTGTTGTACTGCATTGTATTACTTT
GAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan