ESTScan Details for Unigene SGN-U584982

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
HIAPEYXVTGKSSEKTDVFGYGIMLLEIVTGQRAIDFSRLEEEDDVLLLDHVKKLQREKRLDAIVDRNLHKNYNMDEVEMMIQVALLCTQ
GSPEDRPAMSEVVRMLEGEGLAERWEEWQHVEVTRRQEYERLQRRFDWGEDSIYNQDAVELSGGR*
Predicted Coding Sequence 
CATATAGCTCCTGAGTACXTTGTCACTGGGAAATCATCAGAAAAAACTGATGTTTTTGGATATGGGATCATGCTTTTGGAGATTGTAACT
GGTCAACGCGCTATAGACTTTTCACGCCTAGAAGAAGAAGATGATGTCTTGTTACTTGACCATGTTAAAAAACTGCAAAGGGAGAAAAGG
CTGGATGCTATTGTCGACCGCAACCTACATAAGAACTATAACATGGATGAAGTAGAGATGATGATTCAAGTTGCATTGCTGTGTACTCAA
GGATCACCAGAGGACCGTCCAGCAATGTCAGAGGTAGTACGAATGCTTGAAGGAGAGGGACTTGCTGAGCGGTGGGAAGAATGGCAGCAT
GTCGAAGTTACACGTAGGCAAGAATACGAGAGACTACAACGACGATTTGATTGGGGCGAAGATTCAATCTATAATCAAGATGCAGTTGAA
CTGTCTGGTGGAAGATAA
Edits in Original Sequence 
(5')CATATAGCTCCTGAGTACXTTGTCACTGGGAAATCATCAGAAAAAACTGATGTTTTTGGATATGGGATCATGCTTTTGGAGATTGT
AACTGGTCAACGCGCTATAGACTTTTCACGCCTAGAAGAAGAAGATGATGTCTTGTTACTTGACCATGTTAAAAAACTGCAAAGGGAGAA
AAGGCTGGATGCTATTGTCGACCGCAACCTACATAAGAACTATAACATGGATGAAGTAGAGATGATGATTCAAGTTGCATTGCTGTGTAC
TCAAGGATCACCAGAGGACCGTCCAGCAATGTCAGAGGTAGTACGAATGCTTGAAGGAGAGGGACTTGCTGAGCGGTGGGAAGAATGGCA
GCATGTCGAAGTTACACGTAGGCAAGAATACGAGAGACTACAACGACGATTTGATTGGGGCGAAGATTCAATCTATAATCAAGATGCAGT
TGAACTGTCTGGTGGAAGATAA(3')CAAGATCTGTAACTCCAAACAAGTACATAATTTCCTGTAATAGTCTCCTCTTTGATACATAGAA
CTTGTCGCTAAGTGGCAATCATTCCACGTTTTCATATTGCTTGTGTCATATCTTGATTGTATCGTTTTTCGTATGCTTCTCTTATTTAAT
CGATTTTTTCCTGTATGGTTGGTCTGTGCTGCGACATAATATATATCGACTTTCTTTTTGTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan