ESTScan Details for Unigene SGN-U584996

Score 
-57
Direction 
Forward
Predicted Peptide Sequence 
MSFDDDDDHPFFHRKNKYDLNSKIMITAIISLSIVIFFVTLLHIYAEVRPQRQARRRAELQRVSFITSSALHVEPPKTGLDPSVIDSLPV
FILKQNDINQNNTIECTVCLSALEDGERVRNLPNCKHVFHAECIDKWFGSHSTCPICRTEAEPRLLQPGPCEGGVVGPTTPSAPPIEX
Predicted Coding Sequence 
ATGAGTTTTGATGATGATGATGATCATCCATTTTTTCATAGAAAAAACAAATATGATCTTAATAGCAAGATCATGATAACAGCCATAATT
TCATTATCTATAGTTATTTTCTTCGTTACTCTCCTCCATATTTACGCXGAGGTGCGTCCTCAACGCCAGGCTAGACGTAGGGCGGAGCTT
CAGCGCGTCAGCTTCATCACCAGCTCCGCCCTACATGTCGAGCCCCCTAAGACGGGGCTTGACCCGTCCGTGATAGACTCGCTACCGGTA
TTTATTCTCAAACAGAATGATATTAATCAAAATAATACAATTGAGTGCACGGTTTGTTTGAGTGCTCTTGAAGATGGAGAAAGGGTTAGA
AATTTGCCTAATTGCAAACATGTGTTTCATGCTGAGTGTATTGACAAGTGGTTTGGGTCACACTCAACGTGCCCGATTTGTCGGACTGAG
GCTGAGCCCCGGTTGTTACAACCGGGGCCATGTGAAGGGGGXGTGGTAGGTCCTACCACGCCCTCAGCGCCACCAATTGAGGXX
Edits in Original Sequence 
CATAGTTATACCAAACCAAGACAACCTTACCTTTAAATACCTCTTATATTACCCAATAAATAAACATATTACTCTCACAAAACTCCACAA
CATCACGACAACA
(5')ATGAGTTTTGATGATGATGATGATCATCCATTTTTTCATAGAAAAAACAAATATGATCTTAATAGCAAGATCA
TGATAACAGCCATAATTTCATTATCTATAGTTATTTTCTTCGTTACTCTCCTCCATATTTACGCXGAGGTGCGTCCTCAgACGCCAGGCT
AGACGTAGGGCGGAGCTTCAGCGCGTCAGCTTCATCACCAGCTCCGCCCTACATGTCGAGCCCCCTAAGACGGGGCTTGACCCGTCCGTG
ATAGACTCGCTACCGGTATTTATTCTCAAACAGAATGATATTAATCAAAATAATACAATTGAGTGCACGGTTTGTTTGAGTGCTCTTGAA
GATGGAGAAAGGGTTAGAAATTTGCCTAATTGCAAACATGTGTTTCATGCTGAGTGTATTGACAAGTGGTTTGGGTCACACTCAACGTGC
CCGATTTGTCGGACTGAGGCTGAGCCCCGGTTGTTACAACCGGGGCCATGTGAAGGGGGXGTGGTAGGTCCTACCACGCCCTCAGCGCCA
CCAATTGAGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan