ESTScan Details for Unigene SGN-U585012

Score 
907
Direction 
Forward
Predicted Peptide Sequence 
XIVQAWQTGFKRGFRVSSALXSSSSSFCSQNQKKMRGIQLSFSNTQKLRLEKALAQLESFSSKLNSNATVIVADKIPVDEDAALKGHGTL
EMGNDVVASVCGVVERVNKLVYVRPLRARYKPEIGDIIVGRVIEVAPKRWRLEINFSQDAVLMLSSMNLPDGIQRRRTAVDELNMRSIFV
ENDVICAEVRGFQHDGSLHLQARSQKYGKLERGKLLKIPPYLVKRRKQHFHHLDQYGVDLIFGCNGLIWVGEHIDVKDVMVEDQVNKSDP
QNTHSSSLPGSSEEPTDTPLEIRQYICRIANAITVFSALGFMVNLDSMMETVTLSLSLNLGVHEMLEAEFHVRVAEQEAEXTEHIKKEEI
VYNSSSTFAFLGLSIMQKIEEIRXSIKLNRVAAMSPFN*
Predicted Coding Sequence 
XXGATTGTACAAGCTTGGCAAACAGGGTTTAAGAGAGGTTTTAGGGTTTCTTCTGCACTAGXTTCTTCTTCTTCTTCCTTTTGTTCACAA
AATCAGAAAAAAATGAGAGGAATACAGTTATCTTTCAGCAACACCCAAAAGCTAAGATTAGAAAAAGCATTAGCGCAATTGGAATCCTTT
TCTTCGAAGCTTAATTCCAATGCCACTGTCATTGTTGCAGACAAAATTCCAGTCGACGAAGATGCTGCCCTCAAAGGACATGGGACGTTG
GAGATGGGCAATGATGTTGTTGCAAGTGTATGTGGAGTGGTTGAGCGGGTGAATAAGCTTGTTTATGTTAGACCTTTAAGGGCCAGGTAT
AAGCCGGAGATTGGTGATATTATAGTCGGCCGCGTTATTGAGGTTGCTCCAAAGAGATGGAGGTTGGAAATTAATTTCAGCCAAGACGCT
GTACTAATGCTCTCTTCTATGAATCTTCCAGATGGCATTCAGAGGCGGCGAACAGCAGTTGATGAACTCAATATGCGAAGCATATTTGTG
GAGAATGATGTCATCTGTGCTGAAGTCCGTGGTTTCCAACATGATGGGAGTCTACACCTCCAAGCTAGAAGCCAAAAGTATGGAAAGCTT
GAAAGAGGGAAACTACTCAAAATCCCTCCATATCTAGTGAAAAGGCGTAAACAGCATTTCCACCATCTAGATCAGTATGGAGTTGACTTG
ATTTTTGGCTGCAATGGATTAATTTGGGTTGGGGAACACATTGATGTAAAAGATGTAATGGTGGAGGATCAAGTAAATAAGTCCGATCCA
CAGAACACCCATTCATCAAGCTTACCAGGTTCTAGTGAAGAACCAACTGATACACCACTGGAAATAAGACAATATATATGCAGGATAGCA
AATGCCATCACTGTATTCTCAGCTTTAGGCTTCATGGTTAATTTGGACTCCATGATGGAGACAGTTACCTTGAGCTTATCTTTAAACCTT
GGTGTACATGAGATGCTTGAAGCAGAATTCCATGTTCGAGTTGCTGAGCAAGAAGCTGAAXCGACGGAGCACATCAAAAAGGAGGAGATA
GTTTACAACTCATCATCTACATTTGCCTTTCTTGGATTGTCGATTATGCAAAAGATAGAAGAGATTAGGAAXTCTATTAAGCTGAATCGG
GTAGCXGCTATGTCACCCTTTAATTGA
Edits in Original Sequence 
(5')XXGATTGTACAAGCTTGGCAAACAGGGTTTAAGAGAGGTTTTAGGGTTTCTTCTGCACTAGXTTCTTCTTCTTCTTCCTTTTGTTC
ACAAAATCAGAAAAAAATGAGAGGAATACAGTTATCTTTCAGCAACACCCAAAAGCTAAGATTAGAAAAAGCATTAGCGCAATTGGAATC
CTTTTCTTCGAAGCTTAATTCCAATGCCACTGTCATTGTTGCAGACAAAATTCCAGTCGACGAAGATGCTGCCCTCAAAGGACATGGGAC
GTTGGAGATGGGCAATGATGTTGTTGCAAGTGTATGTGGAGTGGTTGAGCGGGTGAATAAGCTTGTTTATGTTAGACCTTTAAGGGCCAG
GTATAAGCCGGAGATTGGTGATATTATAGTCGGCCGCGTTATTGAGGTTGCTCCAAAGAGATGGAGGTTGGAAATTAATTTCAGCCAAGA
CGCTGTACTAATGCTCTCTTCTATGAATCTTCCAGATGGCATTCAGAGGCGGCGAACAGCAGTTGATGAACTCAATATGCGAAGCATATT
TGTGGAGAATGATGTCATCTGTGCTGAAGTCCGTGGTTTCCAACATGATGGGAGTCTACACCTCCAAGCTAGAAGCCAAAAGTATGGAAA
GCTTGAAAGAGGGAAACTACTCAAAATCCCTCCATATCTAGTGAAAAGGCGTAAACAGCATTTCCACCATCTAGATCAGTATGGAGTTGA
CTTGATTTTTGGCTGCAATGGATTAATTTGGGTTGGGGAACACATTGATGTAAAAGATGTAATGGTGGAGGATCAAGTAAATAAGTCCGA
TCCACAGAACACCCATTCATCAAGCTTACCAGGTTCTAGTGAAGAACCAACTGATACACCACTGGAAATAAGACAATATATATGCAGGAT
AGCAAATGCCATCACTGTATTCTCAGCTTTAGGCTTCATGGTTAATTTGGACTCCATGATGGAGACAGTTACCTTGAGCTTATCTTTAAA
CCTTGGTGTACATGAGATGCTTGAAGCAGAATTCCATGTTCGAGTTGCTGAGCAAGAAGCTGAAXCGACGGAGCACATCAAAAAGGAGGA
GATAGTTTACAACTCATCATCTACATTTGCCTTTCTTGGATTGTCGATTATGCAAAAGATAGAAGAGATTAGGAAXTCTATTAAGCTGAA
TCGGGTAGCXGCTATGTCACCCTTTAATTGA(3')AAAAGATCTGTAAAAGAGTTTCCTTCTGAATATCCCCTTAAATTCACACTTTTGA
TTTATGTGCATTAGTAAGGAGTGTGCAGCTGAAGATCAAAGTTTTTCTTCCCAGCAATGAAAATTTTTCTTATGTTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan