ESTScan Details for Unigene SGN-U585061

Score 
447
Direction 
Forward
Predicted Peptide Sequence 
EKPTAPSNIIGDWKVGNCLKFHIRIGTSSELHRASAKSFIVAPSGLQQHQTLTRRKSAPPSTLNQAGASGSKRIVLKESSSESDLDLPFW
QRTWFIVLLLLMAISFFGLALFLFLTLDSDYISTTPVSAASEGVQITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVDDANS
YWAVRSTDSSKQGDPIKSGSIIRLQHIKTRRWLHSHLHASPISGNMEVSCFGDDKESDTGDYWRLEIEGSGKTWRQDQRIRLQHVDTGGY
LHSHDKKYTRIAGGQQEVCGVKEKRPDNVWLAAEGVYFPVTXKKQVKIVDNSMLAEFYL*
Predicted Coding Sequence 
GAAAAGCCCACAGCACCATCAAATATCATCGGAGATTGGAAAGTAGGAAATTGTTTGAAATTTCACATCCGAATCGGAACATCGTCGGAG
CTCCATCGGGCATCCGCAAAGAGCTTCATCGTGGCTCCCTCAGGGTTACAACAACATCAAACTCTTACTAGAAGGAAATCAGCACCGCCG
TCGACATTGAATCAAGCCGGTGCATCGGGCTCGAAGCGAATAGTGCTGAAAGAATCCTCATCCGAATCGGACCTTGATCTTCCATTTTGG
CAAAGAACCTGGTTCATTGTTCTCTTACTTCTCATGGCGATTTCCTTCTTCGGCCTAGCGCTTTTTCTTTTTCTCACCCTGGACTCTGAT
TACATATCAACAACACCTGTCTCCGCTGCTTCCGAAGGCGTCCAGATTACATATGGATCCGCGATTAAGTTGATGCACGAGAAGACAAAG
TTTCGGTTGCATTCCCATGATGTGCCATATGGTTCTGGCAGTGGGCAGCAATCAGTCACTGGATTTCCCGGCGTAGATGATGCTAACAGC
TACTGGGCTGTTAGGAGCACCGACTCGTCCAAGCAAGGTGATCCTATAAAGAGTGGAAGCATCATCAGGCTGCAACATATAAAGACAAGA
AGATGGTTACATAGCCATTTGCATGCTTCTCCCATATCAGGAAATATGGAGGTCAGCTGCTTCGGTGATGACAAGGAATCTGATACAGGG
GACTATTGGAGACTTGAAATTGAGGGCAGTGGGAAAACTTGGAGGCAAGACCAAAGAATCAGGCTTCAACACGTGGACACTGGTGGTTAT
CTCCACAGTCATGACAAGAAATACACCCGAATTGCTGGAGGTCAGCAAGAGGTTTGCGGTGTTAAAGAAAAACGTCCAGATAATGTTTGG
TTGGCAGCAGAGGGTGTCTACTTCCCAGTTACTGAXAAAAAGCAAGTAAAGATTGTTGATAACAGTATGTTAGCTGAATTTTATCTGTAG
Edits in Original Sequence 
(5')GAAAAGCCCACAGCgACCATCAAATATCATCGGAGATTGGAAAGTAGGAAATTGTTTGAAATTTCACATCCGAATCGGAACATCGT
CGGAGCTCCATCGGGCATCCGCAAAGAGCTTCATCGTGGCTCCCTCAGGGTTACAACAACATCAAACTCTTACTAGAAGGAAATCAGCAC
CGCCGTCGACATTGAATCAAGCCGGTGCATCGGGCTCGAAGCGAATAGTGCTGAAAGAATCCTCATCCGAATCGGACCTTGATCTTCCAT
TTTGGCAAAGAACCTGGTTCATTGTTCTCTTACTTCTCATGGCGATTTCCTTCTTCGGCCTAGCGCTTTTTCTTTTTCTCACCCTGGACT
CTGATTACATATCAACAACACCTGTCTCCGCTGCTTCCGAAGGCGTCCAGATTACATATGGATCCGCGATTAAGTTGATGCACGAGAAGA
CAAAGTTTCGGTTGCATTCCCATGATGTGCCATATGGTTCTGGCAGTGGGCAGCAATCAGTCACTGGATTTCCCGGCGTAGATGATGCTA
ACAGCTACTGGGCTGTTAGGAGCACCGACTCGTCCAAGCAAGGTGATCCTATAAAGAGTGGAAGCATCATCAGGCTGCAACATATAAAGA
CAAGAAGATGGTTACATAGCCATTTGCATGCTTCTCCCATATCAGGAAATATGGAGGTCAGCTGCTTCGGTGATGACAAGGAATCTGATA
CAGGGGACTATTGGAGACTTGAAATTGAGGGCAGTGGGAAAACTTGGAGGCAAGACCAAAGAATCAGGCTTCAACACGTGGACACTGGTG
GTTATCTCCACAGTCATGACAAGAAATACACCCGAATTGCTGGAGGTCAGCAAGAGGTTTGCGGTGTTAAAGAAAAACGTCCAGATAATG
TTTGGTTGGCAGCAGAGGGTGTCTACTTCCCAGTTACTGAXAAAAAGCAAGTAAAGATTGTTGATAACAGTATGTTAGCTGAATTTTATC
TGTAG(3')AGACATATTAGTTACTAATGTACCAAAACCTTTTCTAGTACTTTGAGCTGTTGTTAGCATTTTCACTGTTGCAAATGGTAA
CAATTGGTTGATAATTCTTCGCTGCTCGGTTTCCTTGTTACTTCCCTCAGGTGAGGATGATTCTGGTTCAATTATAAAGAAATAGTTAAA
ATGTTAGCCATTCTTCTAATTTCATAGCACTTCTGAATCAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan