ESTScan Details for Unigene SGN-U585096

Score 
1574
Direction 
Forward
Predicted Peptide Sequence 
MAAEAAVAVAAVAPVSAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDGSMGITTTMQAINDKILSLNYGDLRAEIKSVDAQE
SFNGGVHVLVTGYLTGKDNLVRNFCQTFFLAPQDRGYFVLNDMFRYVETASQHDTVQVPVTDAVAPVTPEQIVADPPTAPQNHIPEQSTP
PAEEADVGEVYNPSENGDVLIVEEEVPVSEVVHEVQDGSEVVAESDNKTGEVPKKSYASIVMHLKESAATFSPPPAPAARKPMTKSVVQV
NQPAATTTDGPYSSSETIDNINDTEADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRGFCFGFVEFEVESAVQKAIEASPV
LIGDRQAVVEEKRSTNSRLNARGGGRFQSGRGGGFRNDVGGRGRGNYLGGRGYGRDDFHGRNEFNNRGGNRGGSSNRGGEGYRRADNTGG
RMSRGGGMSNGTAKGPAPRYSATA*
Predicted Coding Sequence 
ATGGCAGCGGAAGCAGCAGTAGCAGTAGCGGCAGTAGCACCAGTTTCTGCTCAAGTTGTTGCGAATGCTTTTGTGCAGCAATACTATCAT
ATATTGCATCATTCGCCGGGGCTTGTATTCAGGTTTTACCAGGATATAAGCAAGCTTGGACGTCCTGAAGAGGATGGATCCATGGGTATC
ACTACGACAATGCAAGCAATAAATGATAAGATACTCTCACTCAACTATGGAGATCTCAGAGCAGAGATCAAGTCTGTGGATGCCCAAGAA
TCCTTTAATGGCGGGGTGCATGTCCTTGTAACTGGATATTTGACTGGGAAAGACAACTTGGTCCGGAATTTCTGTCAAACTTTCTTCCTA
GCACCACAAGATAGGGGGTACTTTGTCTTGAATGATATGTTTCGATATGTAGAGACTGCCAGTCAGCATGATACAGTCCAGGTTCCAGTA
ACTGATGCTGTGGCTCCTGTCACACCAGAGCAAATTGTTGCAGATCCACCTACAGCACCACAGAATCACATTCCTGAGCAAAGCACTCCA
CCAGCAGAGGAAGCTGACGTGGGAGAAGTTTACAACCCATCTGAGAATGGTGATGTGCTTATTGTTGAGGAGGAAGTGCCTGTGTCTGAG
GTCGTCCATGAAGTCCAAGATGGCTCTGAAGTGGTAGCGGAATCTGACAACAAAACTGGGGAAGTTCCTAAGAAGTCATATGCTTCAATT
GTCATGCATCTCAAGGAAAGTGCTGCAACCTTCTCCCCTCCTCCAGCACCTGCTGCTAGGAAGCCTATGACAAAGAGTGTTGTGCAAGTG
AATCAGCCTGCTGCCACAACAACTGATGGCCCATATTCCAGCTCAGAGACCATTGATAACATAAATGACACAGAAGCTGATGGCTACTCA
ATCTATATAAAAGGCCTGCCTATGAGTGCAACTGTGGCATTACTTGCGGATGAGTTCAAGAAGTTTGGGCCAATAAAAAATGGAGGAATT
CAAGTGAGAAGTAACAGGGGATTTTGTTTTGGATTCGTGGAATTTGAAGTGGAAAGTGCTGTGCAAAAAGCAATCGAGGCTTCTCCAGTT
CTCATTGGTGATCGGCAAGCAGTGGTCGAGGAAAAGAGGTCTACCAATTCTCGACTTAATGCCAGAGGTGGTGGTAGGTTTCAATCTGGA
AGGGGCGGTGGATTCAGGAACGATGTTGGAGGAAGAGGGCGAGGAAACTATTTAGGTGGCAGGGGTTATGGTCGAGATGATTTCCATGGA
AGAAATGAGTTCAATAACAGGGGTGGGAATCGTGGGGGTTCATCAAACCGTGGAGGTGAAGGATATCGGCGAGCTGACAATACAGGTGGG
CGAATGAGTCGTGGTGGTGGAATGTCTAATGGAACAGCCAAAGGCCCGGCTCCTCGCTATTCTGCTACAGCTTGA
Edits in Original Sequence 
ACCCTTTCTCTCTCCTTTTTCCACTCTCTCTCTCTACTCGCGCCTCTTTTTCGAGATCCACCACTCTCTCTACAGCAAAACCCTAGAACT
CAAACCTTCCTCCTCCGCATCTAGAGAGAGAAACACACGAAGAGAGAGAAACTCACCGACTGTACATCAAGCTTTCTCTCTTTCCACTTA
TCTGATCCGATATAAATCCAGTGCTATAAACAGGAGTTCGATTGATTGACG
(5')ATGGCAGCGGAAGCAGCAGTAGCAGTAGCGGCAGT
AGCACCAGTTTCTGCTCAAGTTGTTGCGAATGCTTTTGTGCAGCAATACTATCATATATTGCATCATTCGCCGGGGCTTGTATTCAGGTT
TTACCAGGATATAAGCAAGCTTGGACGTCCTGAAGAGGATGGATCCATGGGTATCACTACGACAATGCAAGCAATAAATGATAAGATACT
CTCACTCAACTATGGAGATCTCAGAGCAGAGATCAAGTCTGTGGATGCCCAAGAATCCTTTAATGGCGGGGTGCATGTCCTTGTAACTGG
ATATTTGACTGGGAAAGACAACTTGGTCCGGAATTTCTGTCAAACTTTCTTCCTAGCACCACAAGATAGGGGGTACTTTGTCTTGAATGA
TATGTTTCGATATGTAGAGACTGCCAGTCAGCATGATACAGTCCAGGTTCCAGTAACTGATGCTGTGGCTCCTGTCACACCAGAGCAAAT
TGTTGCAGATCCACCTACAGCACCACAGAATCACATTCCTGAGCAAAGCACTCCACCAGCAGAGGAAGCTGACGTGGGAGAAGTTTACAA
CCCATCTGAGAATGGTGATGTGCTTATTGTTGAGGAGGAAGTGCCTGTGTCTGAGGTCGTCCATGAAGTCCAAGATGGCTCTGAAGTGGT
AGCGGAATCTGACAACAAAACTGGGGAAGTTCCTAAGAAGTCATATGCTTCAATTGTCATGCATCTCAAGGAAAGTGCTGCAACCTTCTC
CCCTCCTCCAGCACCTGCTGCTAGGAAGCCTATGACAAAGAGTGTTGTGCAAGTGAATCAGCCTGCTGCCACAACAACTGATGGCCCATA
TTCCAGCTCAGAGACCATTGATAACATAAATGACACAGAAGCTGATGGCTACTCAATCTATATAAAAGGCCTGCCTATGAGTGCAACTGT
GGCATTACTTGCGGATGAGTTCAAGAAGTTTGGGCCAATAAAAAATGGAGGAATTCAAGTGAGAAGTAACAGGGGATTTTGTTTTGGATT
CGTGGAATTTGAAGTGGAAAGTGCTGTGCAAAAAGCAATCGAGGCTTCTCCAGTTCTCATTGGTGATCGGCAAGCAGTGGTCGAGGAAAA
GAGGTCTACCAATTCTCGACTTAATGCCAGAGGTGGTGGTAGGTTTCAATCTGGAAGGGGCGGTGGATTCAGGAACGATGTTGGAGGAAG
AGGGCGAGGAAACTATTTAGGTGGCAGGGGTTATGGTCGAGATGATTTCCATGGAAGAAATGAGTTCAATAACAGGGGTGGGAATCGTGG
GGGTTCATCAAACCGTGGAGGTGAAGGATATCGGCGAGCTGACAATACAGGTGGGCGAATGAGTCGTGGTGGTGGAATGTCTAATGGAAC
AGCCAAAGGCCCGGCTCCTCGCTATTCTGCTACAGCTTGA(3')AGAGTAGTAGCTTAGTATAATTTATTTGAATCGACATTTAAAATGA
TTTATTGTTAAGGTGAACAGAAATTTTGTCAAGAGCTATGATGTTTTCTCAAAAAGCTCTTTTTGCTAATCTTTTTTCTAGTTCAATTTC
TTTTCTTTTTTTCTGGTTAATTGGATAGGTGGAGGAGGTAGGAATGATTTTTTTTTGAAAGTAGATTTCGTGTGTAGCATACGGGTGTCG
GAGCCCCTAGCAAGAGATTATACTCATTCGTGGGCTTTTGCCTTTTTTGTATTGAATAATTGTTGGGGGCTTGTGGAAATTTATTTATTT
AAACTTCGATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan