ESTScan Details for Unigene SGN-U585158

Score 
1052
Direction 
Forward
Predicted Peptide Sequence 
XIVKVIQIIVALIEIDENESGEVVLPGGISIPNVSKSIKCDKGEHTRVGSDVLSFQQMSEQFNQEVSVNGKIPSGALQYYVRVFWFLAED
AAYTKTLAFDGVFITLYSVALEKSQMVLCDYVKKEVPSTWDPAALARFIEKFGTHVIVGIKMGGKDVIYMKQQHSSSLLPADVQKRLKTM
ADKRFSGANEQGGVESQHTHQNEKFEIREHRLRFADPNISGSYAHKEDTVCICKRRGGSDSRGLMHNQWLQSVDQEPDVISMSFIPITSL
LNGISGSGFLSHAINLYLRYKPPIEELHQFLEFQLPRQWAPVFGDLPLGPQRRHLSFPSLQFSLLGPRLYVNTTPVDVGKRPVTGLRLYL
EGRRSNRLAVHLQHLSSLPKVFQLEDDPKGNFRRESYDRKYYEKVQWKNFSHVCTAPVESDEDLNIVTGAQLELGDYGFKKVLFLRLRFS
TVMGATMVKHAEWDGSPGLARKSGLISTLISQHFTSVQKPPPRPDDVNINSAIYPGGPPVPVQAPKLLKFVDTTEMTRGPQEPPGYWVVS
GARLMVEKGRISVRVKYSLLTVIQPDDEISE*
Predicted Coding Sequence 
XGTATTGTAAAGGTCATCCAGATAATAGTCGCXTTAATTGAAATTGATGAAAATGAGAGTGGGGAGGTTGTGCTTCCTGGTGGAATTTCA
ATACCTAATGTGTCAAAATCTATCAAATGTGATAAAGGAGAACACACACGGGTTGGCTCTGATGTTCTTTCTTTCCAGCAGATGTCAGAG
CAGTTCAATCAGGAAGTATCCGTGAATGGTAAAATTCCTTCXGGCGCTCTTCAATACTATGTTCGAGTTTTCTGGTTCTTGGCAGAAGAT
GCTGCATACACTAAAACCCTTGCTTTTGATGGTGTGTTCATCACGTTGTACTCTGTTGCTCTAGAAAAATCTCAAATGGTGCTGTGTGAT
TATGTTAAAAAGGAAGTTCCATCAACATGGGATCCTGCAGCATTAGCAAGGTTTATTGAAAAATTTGGTACTCATGTCATTGTTGGTATA
AAGATGGGGGGAAAAGATGTAATATATATGAAACAACAGCACTCCTCATCGCTTCTGCCCGCTGACGTGCAAAAACGTTTGAAGACAATG
GCAGATAAGAGGTTTTCAGGTGCAAATGAACAAGGAGGAGTAGAATCGCAGCACACACATCAGAATGAGAAGTTTGAAATCAGGGAGCAC
CGACTGAGGTTTGCCGATCCCAATATATCAGGTTCATATGCACATAAGGAGGATACTGTTTGTATTTGCAAGAGGAGAGGTGGAAGTGAT
AGCAGAGGCCTGATGCATAATCAGTGGTTACAAAGTGTTGATCAGGAGCCTGATGTGATCTCAATGTCCTTCATTCCTATAACTTCACTG
TTGAATGGCATCTCAGGAAGTGGATTTTTAAGTCATGCTATAAATTTGTACTTACGCTATAAACCACCAATTGAAGAGCTTCACCAGTTT
TTGGAATTTCAGCTGCCAAGGCAATGGGCACCAGTATTCGGTGATCTTCCGCTTGGTCCACAGAGAAGGCATTTAAGTTTTCCGTCTTTG
CAGTTCAGTTTACTGGGTCCCAGGCTTTATGTGAACACCACTCCGGTTGATGTTGGCAAGAGGCCGGTGACTGGACTTCGTTTGTACCTT
GAAGGTAGAAGGAGTAACCGCTTAGCCGTCCATTTACAGCATCTTTCATCTCTTCCTAAAGTCTTCCAACTTGAAGATGATCCAAAAGGC
AACTTTCGCCGAGAATCATATGATCGCAAATACTATGAAAAAGTTCAATGGAAGAACTTTTCTCACGTTTGCACCGCACCTGTTGAATCT
GATGAAGACCTTAACATAGTTACTGGAGCACAATTGGAATTAGGGGATTATGGGTTTAAAAAGGTCCTCTTTCTGAGACTCCGTTTCTCG
ACTGTCATGGGAGCTACTATGGTAAAGCACGCTGAGTGGGATGGTTCCCCTGGGTTGGCTCGCAAATCTGGCCTGATATCAACTCTCATT
AGCCAGCACTTTACATCAGTTCAGAAGCCACCTCCTCGGCCAGATGATGTGAACATAAATTCTGCCATTTACCCTGGTGGTCCTCCAGTT
CCTGTGCAAGCCCCTAAGCTCTTGAAATTTGTCGATACTACTGAGATGACTCGAGGACCACAGGAACCTCCTGGTTATTGGGTTGTTTCA
GGTGCAAGGCTTATGGTTGAGAAAGGAAGGATCTCTGTGAGGGTCAAATATTCCTTGCTAACTGTAATACAACCCGATGATGAAATATCA
GAGTAA
Edits in Original Sequence 
(5')XGTATTGTAAAGGTCATCCAGATAATAGTCGCXTTAATTGAAATTGATGAAAATGAGAGTGGGGAGGTTGTGCTTCCTGGTGGAAT
TTCAATACCTAATGTGTCAAAATCTATCAAATGTGATAAAGGAGAACACACACGGGTTGGCTCTGATGTTCTTTCTTTCCAGCAGATGTC
AGAGCAGTTCAATCAGGAAGTATCCGTGAATGGTAAAATTCCTTCXGGCGCTCTTCAATACTATGTTCGAGTTTTCTGGTTCTTGGCAGA
AcGATGCTGCATACACTAAAACCCTTGCTTTTGATGGTGTGTTCATCACGTTGTACTCTGTTGCTCTAGAAAAATCTCAAATGGTGCTGT
GTGATTATGTTAAAAAGGAAGTTCCATCAACATGGGATCCTGCAGCATTAGCAAGGTTTATTGAAAAATTTGGTACTCATGTCATTGTTG
GTATAAAGATGGGGGGAAAAGATGTAATATATATGAAACAACAGCACTCCTCATCGCTTCTGCCCGCTGACGTGCAAAAACGTTTGAAGA
CAATGGCAGATAAGAGGTTTTCAGGTGCAAATGAACAAGGAGGAGTAGAATCGCAGCACACACATCAGAATGAGAAGTTTGAAATCAGGG
AGCACCGACTGAGGTTTGCCGATCCCAATATATCAGGTTCATATGCACATAAGGAGGATACTGTTTGTATTTGCAAGAGGAGAGGTGGAA
GTGATAGCAGAGGCCTGATGCATAATCAGTGGTTACAAAGTGTTGATCAGGAGCCTGATGTGATCTCAATGTCCTTCATTCCTATAACTT
CACTGTTGAATGGCATCTCAGGAAGTGGATTTTTAAGTCATGCTATAAATTTGTACTTACGCTATAAACCACCAATTGAAGAGCTTCACC
AGTTTTTGGAATTTCAGCTGCCAAGGCAATGGGCACCAGTATTCGGTGATCTTCCGCTTGGTCCACAGAGAAGGCATTTAAGTTTTCCGT
CTTTGCAGTTCAGTTTACTGGGTCCCAGGCTTTATGTGAACACCACTCCGGTTGATGTTGGCAAGAGGCCGGTGACTGGACTTCGTTTGT
ACCTTGAAGGTAGAAGGAGTAACCGCTTAGCCGTCCATTTACAGCATCTTTCATCTCTTCCTAAAGTCTTCCAACTTGAAGATGATCCAA
AAGGCAACTTTCGCCGAGAATCATATGATCGCAAATACTATGAAAAAGTTCAATGGAAGAACTTTTCTCACGTTTGCACCGCACCTGTTG
AATCTGATGAAGACCTTAACATAGTTACTGGAGCACAATTGGAATTAGGGGATTATGGGTTTAAAAAGGTCCTCTTTCTGAGACTCCGTT
TCTCGACTGTCATGGGAGCTACTATGGTAAAGCACGCTGAGTGGGATGGTTCCCCTGGGTTGGCTCGCAAATCTGGCCTGATATCAACTC
TCATTAGCCAGCACTTTACATCAGTTCAGAAGCCACCTCCTCGGCCAGATGATGTGAACATAAATTCTGCCATTTACCCTGGTGGTCCTC
CAGTTCCTGTGCAAGCCCCTAAGCTCTTGAAATTTGTCGATACTACTGAGATGACTCGAGGACCACAGGAACCTCCTGGTTATTGGGTTG
TTTCAGGTGCAAGGCTTATGGTTGAGAAAGGAAGGATCTCTGTGAGGGTCAAATATTCCTTGCTAACTGTAATACAACCCGATGATGAAA
TATCAGAGTAA(3')TTTAGAAGAGGTTCTCTTTTATTCATACTCAAAACAATGCAAATGCTACAGGGAGAAGTTGCAGTGTAGTTTGTT
GCTGGCTTTCTTGATGTTGAAACACCTGTTGTACAAAATCTGGCGGAAGTGCCAAAAAAGGGGATGAAGCAACTGTTCTCTACTTTGAGA
TGTCTCTAATCTTTGTTCTGATTTTGTTTGCGATAAAATGTAAATCATGACAATATTGATTGTAATATAATTATCACTTCTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan