ESTScan Details for Unigene SGN-U585198

Score 
795
Direction 
Forward
Predicted Peptide Sequence 
MKMKEIPTLPQDIIIEILIRLPLKTLLKFRSVSKSWLYLLSDAQFHKTHISFSTNNPKFTDYTLAAIPTLSGLGKICHVYTISSENSSVI
VSNMGVLLRLSLSRLGFWGLXNGLICLTSDSFNLMLLNPCTGKFSLFPDLMIEYEVGDGGVHIRYGFGYDASTDDYKVVKMFSFPRIDNE
GRHVNMVSVYSLKGSSWSSIQGFDSGHVNGNVAVFANGVLHWEGCYDYVSGGVSSEIVTLDLAKERYGRIALPRYEGGGIHWTLGESRGR
LVACCNYESDKADMWVLKEYGVEKTWTKVVTISSPDDRRVSISPLFVAENGDEVLVKLGTEVTLYNSRNASFKRIADYVSMDDFLQVQVT
TYLESLASPHI*
Predicted Coding Sequence 
ATGAAGATGAAAGAAATACCAACTCTTCCTCAAGACATCATCATTGAAATTCTCATCAGGTTACCTCTCAAAACTCTCTTGAAATTCAGG
TCTGTTTCCAAATCATGGCTTTATTTACTCTCAGATGCACAATTCCATAAAACCCATATCAGTTTTTCTACGAACAATCCCAAATTTACC
GACTACACCCTTGCTGCTATACCCACTCTTTCTGGTTTGGGCAAAATTTGTCATGTCTACACTATAAGCTCTGAAAATTCATCTGTTATT
GTGTCAAACATGGGTGTCCTTCTAAGACTCTCTCTCTCTCGGCTTGGATTTTGGGGTCTTGXTAATGGGTTAATTTGCTTAACTTCTGAT
TCCTTTAATTTAATGTTATTGAACCCGTGTACTGGAAAGTTTAGTTTATTTCCTGATTTGATGATTGAGTATGAAGTTGGTGATGGTGGT
GTGCATATTCGATATGGGTTTGGTTATGACGCATCTACGGATGATTATAAGGTTGTTAAGATGTTTAGTTTTCCTCGAATCGATAATGAG
GGAAGACATGTTAATATGGTTAGTGTTTATAGCTTAAAGGGTAGTTCTTGGTCAAGTATTCAGGGTTTTGATAGTGGTCATGTAAATGGA
AATGTTGCTGTGTTTGCCAATGGGGTTCTTCATTGGGAAGGATGTTATGATTATGTTTCGGGTGGTGTTTCGTCGGAGATTGTTACGTTG
GATTTGGCTAAAGAGAGATATGGGAGGATAGCTCTGCCTAGGTATGAAGGTGGAGGTATTCATTGGACATTAGGTGAATCGAGAGGGCGT
TTAGTTGCTTGTTGCAATTATGAATCAGATAAGGCAGATATGTGGGTGTTGAAGGAATATGGTGTAGAGAAAACATGGACTAAAGTGGTT
ACCATTTCATCACCGGATGATCGTAGAGTTAGTATCTCGCCGTTGTTTGTGGCAGAGAATGGTGATGAGGTTCTGGTGAAGCTTGGCACA
GAGGTGACACTGTACAATTCAAGGAATGCATCATTCAAGCGAATTGCCGATTATGTGTCTATGGATGATTTTCTTCAAGTTCAAGTGACT
ACCTACTTAGAGAGCCTTGCTTCACCTCATATTTAG
Edits in Original Sequence 
GCATCATTTTACTTTCACATATTCTCTCTTTAACTCCTCTCACTATCTTCTTCTTTCTAAAAGCTACTTTTTCTGTTGCAATACATATAT
ATTTTTCAAAA
(5')ATGAAGATGAAAGAAATACCAACTCTTCCTCAAGACATCATCATTGAAATTCTCATCAGGTTACCTCTCAAAACT
CTCTTGAAATTCAGGTCTGTTTCCAAATCATGGCTTTATTTACTCTCAGATGCACAATTCCATAAAACCCATATCAGTTTTTCTACGAAC
AATCCCAAATTTACCGACTACACCCTTGCTGCTATACCCACTCTTTCTGGTTTGGGCAAAATTTGTCATGTCTACACTATAAGCTCTGAA
AATTCATCTGTTATTGTGTCtAAACATGGGTGTCCTTCTAAGACTCTCTCTCTCTCGGCTTGGATTTTGGGGTCTTGXTAATGGGTTAAT
TTGCTTAACTTCTGATTCCTTTAATTTAATGTTATTGAACCCGTGTACTGGAAAGTTTAGTTTATTTCCTGATTTGATGATTGAGTATGA
AGTTGGTGATGGTGGTGTGCATATTCGATATGGGTTTGGTTATGACGCATCTACGGATGATTATAAGGTTGTTAAGATGTTTAGTTTTCC
TCGAATCGATAATGAGGGAAGACATGTTAATATGGTTAGTGTTTATAGCTTAAAGGGTAGTTCTTGGTCAAGTATTCAGGGTTTTGATAG
TGGTCATGTAAATGGAAATGTTGCTGTGTTTGCCAATGGGGTTCTTCATTGGGAAGGATGTTATGATTATGTTTCGGGTGGTGTTTCGTC
GGAGATTGTTACGTTGGATTTGGCTAAAGAGAGATATGGGAGGATAGCTCTGCCTAGGTATGAAGGTGGAGGTATTCATTGGACATTAGG
TGAATCGAGAGGGCGTTTAGTTGCTTGTTGCAATTATGAATCAGATAAGGCAGATATGTGGGTGTTGAAGGAATATGGTGTAGAGAAAAC
ATGGACTAAAGTGGTTACCATTTCATCACCGGATGATCGTAGAGTTAGTATCTCGCCGTTGTTTGTGGCAGAGAATGGTGATGAGGTTCT
GGTGAAGCTTGGCACAGAGGTGACACTGTACAATTCAAGGAATGCATCATTCAAGCGAATTGCCGATTATGTGTCTATGGATGATTTTCT
TCAAGTTCAAGTGACTACCTACTTAGAGAGCCTTGCTTCACCTCATATTTAG(3')TGACCTGATGGTAAATGATCTCCCTGATTGCCAG
GTGCTCTGTTTTCGAATTTGTTGATAATTTGTGTCATGTCATTGCCTTTTTGAATATTTTCATATCCTGGACAGGTGCTATAAATATCAT
GTTCAATTGGAGTTCTATGTTTGTATACAACTCATATCTTGCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan