ESTScan Details for Unigene SGN-U585255

Score 
1252
Direction 
Forward
Predicted Peptide Sequence 
MVGASLAGLQDHLKLAREYAVEGLYDTSVIFFDGAIAQINKHVNTLDDPLIRSKWMNVKKAISEETEVVKQLDAEKRSFKEVPMGRRPNS
PPISTKSSFVFQPLDEYPTSSGAPMDDPDVWRPPSRDTTRRPGRAGQGGMRKSPQDGAWARASTTRTGTTIRGGRTSGSTKAGTGVRSST
TGKKAPGKSAKSDSTDGEPEEGKSKKGQYEGPDADLAAMLERDVLDNSPGVRWDDVAGLSEAKRLLEEAGALPLWMPEYFQGIRRPWKGV
LMFGPPGTGKTLLANAVATECGTHLTMFIVPPWLQNGVGREKHGAALVDLARSDAPSTIFIDEIDSLCDAPGGSGEHESSRTVKYELLVQ
VYGVSX
Predicted Coding Sequence 
ATGGTGGGTGCATCACTGGCAGGATTGCAAGATCATCTCAAATTGGCTAGAGAATATGCTGTTGAAGGTCTTTATGATACTTCCGTCATC
TTCTTCGATGGCGCAATTGCTCAAATCAATAAGCATGTAAACACACTTGATGATCCTTTGATTCGTTCAAAATGGATGAATGTAAAGAAA
GCCATTTCCGAAGAAACTGAGGTAGTGAAACAATTGGATGCCGAGAAAAGATCTTTTAAGGAGGTTCCTATGGGTAGACGTCCTAATTCA
CCTCCAATTTCAACCAAGTCGTCTTTTGTCTTTCAACCGCTTGATGAGTACCCCACCTCATCTGGTGCTCCAATGGATGACCCTGATGTT
TGGAGACCACCAAGTCGGGACACAACAAGAAGACCTGGAAGAGCAGGTCAGGGGGGTATGAGAAAGTCCCCACAAGATGGAGCGTGGGCT
CGTGCATCTACTACAAGGACTGGAACAACAATCCGTGGGGGAAGGACCAGTGGCTCTACTAAGGCTGGTACTGGGGTTCGATCTTCAACT
ACTGGGAAAAAAGCACCTGGAAAATCTGCAAAGTCCGACTCTACGGATGGTGAACCTGAAGAGGGGAAGAGTAAAAAAGGTCAGTACGAA
GGGCCTGATGCAGACCTGGCTGCTATGCTTGAGAGAGATGTCTTGGATAATAGCCCTGGTGTGAGATGGGACGATGTTGCTGGGTTAAGT
GAGGCCAAAAGACTTCTGGAGGAAGCAGGAGCTCTTCCACTGTGGATGCCAGAATATTTCCAGGGAATCAGGAGACCATGGAAGGGTGTT
CTTATGTTTGGGCCTCCTGGAACGGGGAAGACACTTTTGGCTAATGCTGTTGCTACCGAGTGTGGGACACATTTGACAATGTTTATTGTG
CCACCTTGGCTTCAAAATGGCGTGGGGAGAGAGAAGCATGGAGCGGCGCTTGTTGATCTTGCTCGCTCTGATGCTCCCAGTACAATTTTC
ATTGATGAGATTGATTCTCTTTGTGATGCCCCAGGGGGTTCAGGAGAGCATGAATCATCCCGAACGGTGAAGTATGAACTTCTTGTTCAG
GTATATGGTGTAAGCAXX
Edits in Original Sequence 
CCCCAGAGGCCCATATATATATATAGAGAGAGAAAATAGAGAGAGAAAGGGAGAGATATTTTCGAATTTGTTTTTGTTTGCTGAATATTT
GGAAACCCTAACATTTGGGGATTTGGTTTAAGGAAATTATCGACAGATTTGAGTTTTGAGGAATTGATA
(5')ATGGTGGGTGCATCACT
GGCAGGATTGCAAGATCATCTCAAATTGGCTAGAGAATATGCTGTTGAAGGTCTTTATGATACTTCCGTCATCTTCTTCGATGGCGCAAT
TGCTCAAATCAATAAGCATGTAAACACACTTGATGATCCTTTGATTCGTTCAAAATGGATGAATGTAAAGAAAGCCATTTCCGAAGAAAC
TGAGGTAGTGAAACAATTGGATGCCGAGAAAAGATCTTTTAAGGAGGTTCCTATGGGTAGACGTCCTAATTCACCTCCAATTTCAACCAA
GTCGTCTTTTGTCTTTCAACCGCTTGATGAGTACCCCACCTCATCTGGTGCTCCAATGGATGACCCTGATGTTTGGAGACCACCAAGTCG
GGACACAACAAGAAGACCTGGAAGAGCAGGTCAGGGGGGTATGAGAAAGTCCCCACAAGATGGAGCGTGGGCTCGTGCATCTACTACAAG
GACTGGAACAACAATCCGTGGGGGAAGGACCAGTGGCTCTACTAAGGCTGGTACTGGGGTTCGATCTTCAACTACTGGGAAAAAAGCACC
TGGAAAATCTGCAAAGTCCGACTCTACGGATGGTGAACCTGAAGAGGGGAAGAGTAAAAAAGGTCAGTACGAAGGGCCTGATGCAGACCT
GGCTGCTATGCTTGAGAGAGATGTCTTGGATAATAGCCCTGGTGTGAGATGGGACGATGTTGCTGGGTTAAGTGAGGCCAAAAGACTTCT
GGAGGAAGCAGGAGCTCTTCCACTGTGGATGCCAGAATATTTCCAGGGAATCAGGAGACCATGGAAGGGTGTTCTTATGTTTGGGCCTCC
TGGAACGGGGAAGACACTTTTGGCTAATGCTGTTGCTACCGAGTGTGGGACgACATTTGACAATGTTTATTGTGCCACCTTGGCTTCAAA
ATGGCGTGGGGAGAGAGAAcGCATGGAGCGGCGCTTGTaTGATCTTGCTCGCTCTGATGCTCCCAGTACAATTTTCATTGATGAGATTGA
TTCTCTTTGTGATGCCCCAGGGGGTTCAGGAGAGCATGAATCATCCCGAACGGTGAAGTATGAACTTCTTGTTCAGGTATATGGTGTAAG
CAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan