ESTScan Details for Unigene SGN-U585293

Score 
319
Direction 
Forward
Predicted Peptide Sequence 
XAHMHSMGGPKFTHGNIKXLKRGLKQDMEACISDFGLAPIMNFPAAPSRYPGYRAPEVIESRKHSHKSDVYSFGVLLLEMLTGKQPMQSP
GRDDMVDLPRWVQSVVREEWTSEVFDVDLMRFQNIEEEMVQMLQIAMACVVKVPDMRPNMEEVVRMIEDVRQSTPKTGILQKENRSYDSN
XAYPLIPWISDLQFASAEKFIRFRLPSATTYMFSFPKFSDSILLTSVSSESVDLFSLGDIVDKLIIFLFLFV*
Predicted Coding Sequence 
XXCGCCCACATGCATTCAATGGGTGGTCCAAAATTTACTCATGGAAATATAAAGXTCCTCAAACGTGGACTCAAGCAAGATATGGAAGCT
TGCATCTCAGATTTTGGTTTAGCCCCTATAATGAACTTCCCTGCAGCCCCATCCCGATATCCAGGGTACCGGGCTCCTGAGGTGATAGAA
AGCCGAAAGCATAGTCATAAATCAGATGTCTACAGCTTCGGTGTGTTACTACTCGAGATGCTTACTGGTAAGCAGCCAATGCAATCACCG
GGGCGTGATGACATGGTTGACCTTCCTAGGTGGGTCCAATCAGTTGTCAGGGAGGAATGGACATCAGAGGTTTTTGACGTCGATTTGATG
AGATTTCAAAACATTGAAGAAGAGATGGTACAAATGCTGCAAATTGCTATGGCATGTGTTGTAAAGGTCCCAGACATGCGACCCAACATG
GAGGAAGTTGTTAGAATGATTGAAGACGTCAGGCAATCAACTCCGAAAACAGGCATTCTTCAGAAAGAGAATAGATCCTATGATTCAAAT
GXTGCATATCCCTTGATTCCTTGGATTTCTGACTTACAATTTGCAAGTGCAGAGAAGTTCATTCGATTTCGATTACCCAGTGCAACAACA
TACATGTTTTCTTTCCCTAAATTTTCTGATTCAATCCTATTGACAAGTGTATCTAGTGAAAGTGTGGATTTGTTTTCCTTAGGAGATATA
GTAGACAAGTTAATCATCTTCCTTTTTCTTTTCGTTTAA
Edits in Original Sequence 
(5')XXCGCCCACATGCATTCAATGGGTGGTCCAAAATTTACTCATGGAAATATAAAGXTCCTCAAACGTGcGACTCAAGCAAGATATGG
AAGCTTGCATCTCAGATTTTGGTTTAGCCCCTATAATGAACTTCCCTGCAGCCCCATCCCGATATCCAGGGTACCGGGCTCCTGAGGTGA
TAGAAAGCCGAAAGCATAGTCATAAATCAGATGTCTACAGCTTCGGTGTGTTACTACTCGAGATGCTTACTGGTAAGCAGCCAATGCAAT
CACCGGGGCGTGATGACATGGTTGACCTTCCTAGGTGGGTCCAATCAGTTGTCAGGGAGGAATGGACATCAGAGGTTTTTGACGTCGATT
TGATGAGATTTCAAAACATTGAAGAAGAGATGGTACAAATGCTGCAAATTGCTATGGCATGTGTTGTAAAGGTCCCAGACATGCGACCCA
ACATGGAGGAAGTTGTTAGAATGATTGAAGACGTCAGGCAATCtAACTCCGAAAACAGGCATTCTTCAGAAAGAGAATAGATCCTATGAT
TCAAATGXTGCATATCCCTTGATTCCTTGGATTTCTGACTTACAATTTGCAAGTGCAGAGAAGTTCATTCGATTTCGATTACCCAGTGCA
ACAACATACATGTTTTCTTTCCCTAAATTTTCTGATTCAATCCTATTGACAAGTGTATCTAGTGAAAGTGTGGATTTGTTTTCCTTAGGA
GATATAGTAGACAAGTTAATCATCTTCCTTTTTCTTTTCGTTTAA(3')GAACTCTAGTCATTTGTTGTAAGATTCAATCTGCACTGCAC
TTATTCAACATCTCATTTATGCAACATGTCGAAGCAATTCAAAAAAAAAAACAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan