ESTScan Details for Unigene SGN-U585423

Score 
244
Direction 
Reverse
Predicted Peptide Sequence 
MRITKGPPSLSRQYSTTIESPKPELEKXNLELKTPQQGVGKRCLGRSEKEKKETEEGNAGKGPTAIIYEQHMNWPESHISPTDKDYMSLT
SLQFADISPEALKDCTLGXVKVMLTGPASLVIFPCDSCENVSLARNVWSDPPTTX
Predicted Coding Sequence 
ATGAGAATCACCAAAGGCCCTCCATCATTATCTAGACAATATAGTACAACCATTGAAAGCCCAAAACCAGAGTTAGAAAAGAXCAATTTA
GAACTCAAGACACCTCAACAGGGAGTGGGCAAAAGATGTTTAGGAAGAAGTGAAAAAGAGAAGAAAGAAACCGAGGAGGGTAATGCTGGA
AAAGGTCCAACAGCCATCATATACGAGCAACATATGAATTGGCCTGAGTCACATATCTCACCCACCGATAAGGATTATATGTCTTTGACT
TCTTTGCAATTTGCAGATATTTCACCTGAAGCCTTGAAGGATTGTACATTGGGAXTTGTGAAGGTCATGCTCACTGGTCCAGCTTCCTTG
GTGATATTTCCATGTGACTCTTGTGAAAATGTTAGCTTGGCACGTAATGTATGGTCTGATCCACCGACAACCCXX
Edits in Original Sequence 
AAATAGCAAAATTTTCCATTAGTTGCACAATTTTTTAAA(5')ATGAGAATCACCAAAGaGCCCTCCATCATTATCTAGACAATATAGTA
CAACCATTGAAAGCCCAAAACCAGAGTTAGAAAAGAXCAATTTAGAACTCAAGACACCTCAACAGGGAGTGGGCAAAAGATGTTTAGGAA
GAAGTGAAAAAGAGAAGAAAGAAACCGAGGAGGGTAATGCTGGAAAAGGTCtCAACAGCCATCATATACGAGCAACATATGAATTGGCCT
GAGTCACATATCTCACCCACCGATAAGGATTATATGTCTTTGACTTCTTTGCAATTTGCAGATATTTCACCTGAAGCCTTGAAGGATTGT
ACATTGGGAXTTGTGAAGGTCATGCTCACTGGTCCAGCTTCCTTGGTGATATTTCCATGTGACTCTTGTGAAAATGTTAGCTTGGCACGT
AATGTATGGTCTGATCCACCGACAACCCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan