ESTScan Details for Unigene SGN-U585462

Score 
483
Direction 
Forward
Predicted Peptide Sequence 
XPDDNSALKPPNVYGSIELKNIDFSYPSRPEVLVLSNFTLKVNGGQTVAVGGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKSYNLRW
LRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEMKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLD
EASSSIESESSRVIQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDTLMSKNGLYXPPDATSLWEGIAVNIDLFKNG
SNATEGXISFSMKLGMVADFKRPNPYCKIPASNWTDEAKKNDEDFYTLFAVDYHVWAVKLGXVIRLMLVQIDIEDDRMSGLEPYSFGGRP
VV*
Predicted Coding Sequence 
XTGCCAGATGACAACTCCGCCTTAAAACCGCCAAATGTCTATGGAAGTATTGAGTTGAAAAACATTGATTTCTCATATCCATCTCGACCA
GAAGTCCTGGTACTGAGCAATTTCACTCTAAAAGTCAACGGAGGGCAAACTGTAGCTGTGGGGGGGGTTTCCGGCTCAGGAAAGAGCACA
ATTATATCTTTAATAGAGAGGTTTTATGACCCTGTTGCTGGTCAGGTTTTACTTGATGGCCGTGATTTAAAGTCATACAATTTACGATGG
TTGAGGAACCACTTAGGACTTGTTCAGCAGGAACCAATTATCTTTTCAACCACCATTAGGGAAAACATAATCTATGCAAGGCACAATGCT
AGTGAAGCTGAGATGAAAGAAGCCGCTAGAATAGCAAATGCTCATCATTTCATCAGCAGTTTGCCTCATGGTTACGACACACATGTTGGG
ATGAGGGGGGTAGATCTGACTCCTGGGCAGAAGCAAAGAATTGCAATAGCTCGTGTTGTTCTGAAGAATGCACCTATTCTGTTATTGGAT
GAAGCAAGCTCCTCCATTGAATCTGAGTCGAGCCGAGTGATACAGGAGGCTCTTGATACTCTAATCATGGGGAACAAGACAACTATTTTA
ATTGCCCACCGAGCTGCCATGATGAGGCATGTTGACAACATAGTTGTACTTAATGGAGGGAGGATTGTTGAGGAAGGTACCCACGATACA
CTGATGTCAAAAAATGGTTTGTATGXTCCGCCTGATGCAACCTCACTTTGGGAAGGGATTGCXGTCAACATAGACTTGTTTAAAAACGGA
AGCAATGCAACTGAAGGTXACATCTCATTTTCAATGAAGCTGGGAATGGTAGCAGATTTCAAACGTCCAAATCCTTACTGTAAAATCCCA
GCTTCAAACTGGACAGATGAAGCAAAGAAGAATGATGAGGATTTCTACACTTTGTTTGCTGTTGATTATCACGTTTGGGCAGTGAAACTT
GGTXATGTAATTAGACTGATGCTTGTTCAAATTGATATCGAGGATGATAGGATGTCAGGACTAGAACCCTATTCTTTTGGAGGCAGGCCG
GTTGTGTAG
Edits in Original Sequence 
(5')XTGCCAGATGACAACTCCGCCTTAAAACCGCCAAATGTCTATGGAAGTATTGAGTTGAAAAACATTGATTTCTCATATCCATCTCG
ACCAGAAGTCCTGGTACTGAGCAATTTCACTCTAAAAGTCAACGGAGGGCAAACTGTAGCTGTGGGGGGGGTTTCCGGCTCAGGAAAGAG
CACAATTATATCTTTAATAGAGAGGTTTTATGACCCTGTTGCTGGTCAGGTTTTACTTGATGGCCGTGATTTAAAGTCATACAATTTACG
ATGGTTGAGGAACCACTTAGGACTTGTTCAGCAGGAACCAATTATCTTTTCAACCACCATTAGGGAAAACATAATCTATGCAAGGCACAA
TGCTAGTGAAGCTGAGATGAAAGAAGCCGCTAGAATAGCAAATGCTCATCATTTCATCAGCAGTTTGCCTCATGGTTACGACACACATGT
TGGGATGAGGGGGGTAGATCTGACTCCTGGGCAGAAGCAAAGAATTGCAATAGCTCGTGTTGTTCTGAAGAATGCACCTATTCTGTTATT
GGATGAAGCAAGCTCCTCCATTGAATCTGAGTCGAGCCGAGTGATACAGGAGGCTCTTGATACTCTAATCATGGGGAACAAGACAACTAT
TTTAATTGCCCACCGAGCTGCCATGATGAGGCATGTTGACAACATAGTTGTACTTAATGGAGGGAGGATTGTTGAGGAAGGTACCCACGA
TACACTGATGTCAAAAAATGGTTTGTATGXTCCGCCTGATGCAACCTCACTTTGGGAAGGGATTGCXGTCAACATAGACTTGTTTAAAAA
CGGAAGCAATGCAACTGAAGGTXACATCTCATTTTCAATGAAGCTGGGAATGGTAGCAGATTTCAAACGTCCAAATCCTTACTGTAAAAT
CCCAGCTTCAAACTGGACAGATGAAGCAAAGAcAGAATGATGAGGATTTCTaACACTTTGTTTGCTGTTGATTATCACGTTTGGGCAGTG
AAACTTGGTXATGTAATTAGACTGATGCgTTGTTCAAATTGATATCGAGGATGATAGGATGTCAGGACTAGAACCCTATTCTTTTGGAGG
CAGGCCGGTTGTGTAG(3')ATCAGGTTTATGCTCCGTCTCCTGATGGTATATTGATTTGTTAATTATAGAGTGGAATGAGTAGCCATAG
CTTTGATCAGGTCGAGATTCTTCATTTTCTTCTGTATTCTTTCTTCCTTTCGGGTTGCGTCTCTGTGTGTGTTGTAGTCAAGTCAAGTGA
TGTTCATTATTTTCGTGACGAAAAATCCCCCTCTCCACTTTTCTGCTGTATATTTTTCTAACAGGGAAGCCATAGAGATGATTTCACCAT
CAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan